KEGG   Bacillus mycoides KBAB4: BcerKBAB4_5565
Entry
BcerKBAB4_5565    CDS       T00642                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K20418  L-isoleucine 4-hydroxylase [EC:1.14.11.45]
Organism
bwe  Bacillus mycoides KBAB4
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BcerKBAB4_5565
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.45  L-isoleucine 4-hydroxylase
     BcerKBAB4_5565
SSDB
Motif
Pfam: 2OG-Fe_Oxy_2
Other DBs
NCBI-ProteinID: ABY46544
UniProt: A9VUH3
LinkDB
Position
pBWB401:complement(167829..168569)
AA seq 246 aa
MLTTVSNKTSSFDVEQKVHEFESNGYIQIFNDIFLQDQEDQALLTKAQLDYYSLQNDAYG
ECRARAYSRYIKYAGSSDYVLDTDNGYFQSEEYNYDDGGKIRNFNSITDEFLHNSLIEKI
VRFDSEFASNTNILDTSKDLVIGLHQVRYKATRENPSFSSPIWLHKDDEPIVFLHLMNLS
NTALGGDNLIANSPREINKLISLKDPLETLVFGQKVFHAVTPLGTECNTEALRDILLVTF
SYKEPK
NT seq 741 nt   +upstreamnt  +downstreamnt
atgctaacaacagtttctaataagacaagcagttttgacgtagaacaaaaggtacatgaa
ttcgaatcaaatggatacattcaaatctttaatgatatttttttacaagatcaagaagat
caagcattactaacgaaagcacagttagactactacagcttacaaaacgacgcatatggc
gaatgtcgcgctagagcctattcaagatatataaaatacgctggttcttcagattatgtt
ctagatacagacaatggatatttccaatctgaagaatataattatgacgatggtgggaaa
attagaaatttcaacagtataacagatgaatttttacataattcattaattgagaaaatt
gttcgctttgatagtgaatttgcatctaatacaaatatacttgatacaagtaaggatttg
gttataggtctacatcaagtaagatataaggcaactagagaaaatccttcttttagctct
ccaatttggctacataaggatgatgagccgattgtctttttacatctcatgaatttaagt
aatacagctcttggcggagacaatctgattgcaaacagccctagggaaattaacaagctt
attagcttgaaggatcccctagaaactttagtatttggacaaaaggtattccacgctgta
acaccactaggaacagagtgtaatacagaagccttacgtgacattttattagtaacgttt
tcttataaggagccaaaatga

DBGET integrated database retrieval system