KEGG   Paraburkholderia xenovorans LB400: DR64_8609
Entry
DR64_8609         CDS       T03290                                 

Gene name
bphE
Definition
(GenBank) biphenyl dioxygenase subunit beta
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00621  Dioxin degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Module
bxb_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DR64_8609 (bphE)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     DR64_8609 (bphE)
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: AIP34474
UniProt: P37334
LinkDB
Structure
PDB: 

Position
3:1288200..1288766
AA seq 188 aa
MTNPSPHFFKTFEWPSKAAGLELQNEIEQFYYREAQLLDHRAYEAWFALLDKDIHYFMPL
RTNRMIREGELEYSGDQDLAHFDETHETMYGRIRKVTSDVGWAENPPSRTRHLVSNVIVK
ETATPDTFEVNSAFILYRNRLERQVDIFAGERRDVLRRADNNLGFSIAKRTILLDASTLL
SNNLSMFF
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacaaatccatccccgcattttttcaaaacatttgaatggccaagcaaggcggctggc
cttgagttgcagaacgagatcgagcagttctactaccgcgaagcgcagttgcttgaccac
cgggcctacgaggcctggtttgccctgctggacaaagatatccactacttcatgccgctg
cgcaccaatcgcatgatccgggagggcgagctggaatattccggcgaccaggatttagcc
catttcgatgaaacccatgaaaccatgtacgggcgcatccgcaaggtgacctcggacgtg
ggctgggcggagaacccgccttcccgcacgcgccacctggtctccaacgtcatcgtcaag
gagacggccacgccggataccttcgaggtcaattccgcattcatcctgtaccgcaatcgg
cttgagcgccaggtcgacatcttcgcgggcgaacgccgggacgtgctgcgccgcgccgac
aacaaccttggtttcagcatcgccaagcgcaccatcctgctcgacgccagtaccttgctg
tcgaacaacctgagcatgttcttctag

DBGET integrated database retrieval system