Paraburkholderia xenovorans LB400: Bxe_B2777 Help Entry Bxe_B2777         CDS       T00340                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism bxe  Paraburkholderia xenovorans LB400 Brite KEGG Orthology (KO) [BR:bxe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bxe03036]     Bxe_B2777    03400 DNA repair and recombination proteins [BR:bxe03400]     Bxe_B2777 Chromosome and associated proteins [BR:bxe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Bxe_B2777 DNA repair and recombination proteins [BR:bxe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Bxe_B2777 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ABE33218 UniProt:  Q13RS1 LinkDB All DBs Position 2:286700..286963 Genome browser AA seq 87 aa AA seqDB search MKEREEQRLFDLDGNARERLIVWIRRRMDEYGITMEALAEAIEADASATRAVMYRDAYGN TWDGHGDKPDWLARAIYAGQSMDHFRC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaagagcgagaagaacaacggctgttcgacctcgacgggaatgcgcgtgagcgcctg atcgtgtggatccgccggcgcatggacgaatacggcattacgatggaagcgctcgccgag gcgatcgaagcggatgcgtccgcaacgcgggccgtcatgtatcgcgacgcctacggcaat acctgggacggtcacggcgataagccggattggctcgcacgcgcgatttacgccggacag agcatggatcatttccgttgctaa

DBGET integrated database retrieval system