KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01611
Entry
BAXH7_01611       CDS       T01836                                 
Symbol
bioI
Name
(GenBank) cytochrome P450 for pimelic acid formation for biotin biosynthesis
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00780  Biotin metabolism
bxh01100  Metabolic pathways
bxh01240  Biosynthesis of cofactors
Module
bxh_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAXH7_01611 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bxh00199]
    BAXH7_01611 (bioI)
Enzymes [BR:bxh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BAXH7_01611 (bioI)
Cytochrome P450 [BR:bxh00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BAXH7_01611 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AEK88749
LinkDB
Position
1489397..1490593
AA seq 398 aa
MTAGLSIAHPSLHADSDFWNNPYPFYDKLRAVDPVYQGTVLKYPGRYITGYQEAEAVLKD
TRFKNRIPMPEASAKYKHLKNLQKDMLLFTNHSDHKRLRMLIGKAFTLKKAERLKPFITA
TVHDVLDQIDHSKTADLVSDFAFPVASLVIADILGVPKEDRASFREWTADVIQAIDLTRS
KKSLLKAGGTAGKLTAYFKDLIQKRKTEPQKDVITTLISEEQLTEEEVLASCILLIIAGH
ETTVNLICNGVFSLLKHPAELSKLLENPQLIASATEEFLRFESPAQLTARTASEDCVINQ
HLIKKGEQVYILLGAANRDPEVFHRPHQLDITRNPNPHLAFGKGAHVCIGSSLARIEAQT
AILTLLERAPDIRLVKTDVTYRKLFGFRSLSALPVVLS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcctatcgattgcacatccgtccctccatgcggattcagatttttggaat
aacccttatccgttttatgacaaactgcgggccgttgatcccgtgtatcaaggaaccgtt
ttaaaatacccggggcgctacatcaccggatatcaagaagcggaagccgtcctgaaagac
accagatttaaaaaccgcattccgatgcctgaagcgtcagctaaatataaacacctgaaa
aacttgcagaaggatatgctgctgtttacgaatcactcagaccataagcggcttcgcatg
ctgatcggcaaagcattcactctgaaaaaagcggagcggctgaaaccctttataacagca
acggttcatgatgtgttagaccaaatagatcacagtaaaaccgcagaccttgtatcagac
ttcgccttcccagtggcgagtctcgtcattgcggacatactcggggtgccgaaagaagac
agagcaagcttcagggagtggaccgcggacgtcattcaggccattgacctgacacgctct
aaaaagtcgctgcttaaagccggcggtacagccggcaagctgacggcgtattttaaagat
ttgattcaaaaacggaaaacagagccccaaaaagacgtcatcaccacacttatcagcgaa
gaacagcttacagaagaagaagtgctcgcatcctgcatcctgctcattatcgccggacac
gaaacgacggtgaatctgatctgcaatggcgtgttttcattattgaaacatccggccgag
ctcagcaaattgctggaaaatccgcagctgattgcatctgcaactgaggaatttctacgc
tttgaaagcccggcgcagctgacggctcgtacagcttcagaagactgcgtcatcaatcag
cacctcataaaaaaaggagagcaggtatatattctgttaggcgcagccaaccgcgacccg
gaggtatttcatcgtccccatcagctggacattacgagaaatcccaatccgcatctggca
ttcggaaaaggcgcccacgtctgtatcggctcctcattagcgcggattgaggcccaaacg
gccatcctcacactgctggagcgggcccctgatattcgccttgtgaaaacagatgttaca
taccgcaaactcttcggtttcaggtcgctttcagcgcttccggttgttctcagctga

DBGET integrated database retrieval system