KEGG   Bacillus xiamenensis: BK049_02615
Entry
BK049_02615       CDS       T04852                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bxi  Bacillus xiamenensis
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bxi03000]
    BK049_02615
Transcription factors [BR:bxi03000]
 Prokaryotic type
  Other transcription factors
   Others
    BK049_02615
SSDB
Motif
Pfam: Bmp Peripla_BP_4 PP_kinase_C_1
Other DBs
NCBI-ProteinID: AOZ87691
UniProt: K2NCV7
LinkDB
Position
complement(520110..521069)
AA seq 319 aa
MKYQRLVMIFSFLLLLSACSQAPLKGHIEKVGLLVPDTINDQVWGTKGYKGLLNIQSTFG
VDVYYKEGMVDKEKIVDAIEEFHKKGVNLIIGHGNEYSEIFNLISEDYPKTQFITVNGGK
PQADNVTNVTFKGEAMGFFGGMTAAHMSKTKKIGILATYDWQSEVDGFIKGAKYQDAHVQ
VLAEFVENWDDADKAVNLYQKLKKQGVDVVYPAGDGYNIPVIEQIKNDNLSAIGYVTDQS
NLGSHTVLTSTVQHVDKAYSIIAKKFNEGKLNEGEYSFDFKEGVIEMGKFSSTIDRDFVK
DIENDISYYKKTGKLPNEK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagtaccaacggcttgtcatgatcttttcgttccttcttttattatctgcctgctcg
caggcgcctttaaaaggacatattgagaaggtgggtttactcgtccccgatacgattaat
gatcaagtttggggaacgaaaggttataaaggcttattaaatatccaatcaacatttggt
gtagatgtttattataaggaaggcatggtcgacaaggagaaaatcgttgatgccattgaa
gagttccataaaaaaggagtcaatttgattattggccatggcaatgaatacagcgaaatt
ttcaacttgatcagtgaagattatccaaaaacacaatttattacggtcaatggaggcaag
cctcaggctgacaatgtcacaaacgtgacgtttaaaggagaagcaatgggctttttcgga
ggcatgactgcagcacatatgtccaaaacaaaaaagattggtattcttgctacatatgat
tggcaaagcgaagtagacggctttatcaaaggggcaaaatatcaagacgcacatgtgcaa
gttctagcggaatttgtcgaaaactgggatgatgctgacaaagctgtgaacctctatcaa
aaattgaaaaaacaaggtgtagatgttgtgtatccagcaggtgatggttataatatccct
gtcattgaacaaatcaaaaacgacaatttatctgcgatcggatatgtcactgatcaatcg
aaccttggaagccataccgtcttaaccagcacagtacagcatgttgataaagcgtacagt
atcattgcgaagaagtttaatgaaggcaaactaaacgaaggtgaatactcctttgacttt
aaagaaggagtgatcgaaatgggtaaatttagctcaaccattgaccgcgattttgtgaaa
gacatagagaatgatatctcgtattacaaaaaaacgggcaaactgcctaatgaaaagtga

DBGET integrated database retrieval system