Caulobacter sp. K31: Caul_5339 Help Entry Caul_5339         CDS       T00651                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism cak  Caulobacter sp. K31 Pathway cak03030   DNA replication cak03430   Mismatch repair cak03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cak00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Caul_5339    03430 Mismatch repair     Caul_5339    03440 Homologous recombination     Caul_5339  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cak03032]     Caul_5339    03400 DNA repair and recombination proteins [BR:cak03400]     Caul_5339    03029 Mitochondrial biogenesis [BR:cak03029]     Caul_5339 DNA replication proteins [BR:cak03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Caul_5339 DNA repair and recombination proteins [BR:cak03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Caul_5339   TLS (translesion DNA synthesis) factors    Other SOS response factors     Caul_5339 Mitochondrial biogenesis [BR:cak03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Caul_5339 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB GW Motif Other DBs NCBI-ProteinID:  ABZ74458 UniProt:  B0T9Q9 LinkDB All DBs Position pCAUL02:complement(50088..50456) Genome browser AA seq 122 aa AA seqDB search MLNKVQLIGFTGAEAEIRTTSGGKKVATLRVATNRYTKAGGERKDYTTWHQVEIWNQGTV GWLGSKALPTGSKVFVEGEIRHDRYTDKDGVERFFSKVVVATPQHELRSLDRPDAAPASE EE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgctgaacaaggtccaattgatcggtttcaccggagccgaagcggaaattcgcaccacg tcaggcggcaagaaggtcgccaccctgcgggtcgccaccaaccgctacacgaaggcgggc ggcgagcggaaggactacacgacctggcaccaggtcgagatttggaaccagggcacagtg ggctggctcggctccaaggcgctgccgacgggctcgaaggtgttcgtcgagggggagatc cggcacgaccgctacaccgacaaggacggtgtggagcggttcttctccaaggtcgtggtt gccacgccgcagcatgaactgcggtcgctggaccggcctgacgccgctccggcctccgag gaggagtag

DBGET integrated database retrieval system