Candida albicans: CAALFM_C107280CA Help Entry CAALFM_C107280CA  CDS       T00189                                  Name (RefSeq) TFIIH complex subunit   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism cal  Candida albicans Pathway cal03022   Basal transcription factors cal03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cal00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     CAALFM_C107280CA   09124 Replication and repair    03420 Nucleotide excision repair     CAALFM_C107280CA  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cal03021]     CAALFM_C107280CA    03400 DNA repair and recombination proteins [BR:cal03400]     CAALFM_C107280CA Transcription machinery [BR:cal03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      CAALFM_C107280CA DNA repair and recombination proteins [BR:cal03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      CAALFM_C107280CA BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  30515021 NCBI-ProteinID:  XP_019330670 UniProt:  P0C0X3 LinkDB All DBs Position 1:complement(1560696..1560905) Genome browser AA seq 69 aa AA seqDB search MLVASKGVLVQCDPSIKALIIQIDSSSSGIILEELDETHLLIQHDKVNFVKSELNRLLSK NIYNPFEEE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgttagtagcaagtaaaggagtgctagttcaatgtgatccatccatcaaagctttgatt attcagattgatagctcaagctcaggaatcattctagaggaattagacgaaacacattta ctaattcagcatgataaagtgaactttgttaaatccgaactaaatcgattgctatccaaa aatatttacaatccgtttgaagaggaataa

DBGET integrated database retrieval system