KEGG   Candida albicans: CAALFM_C302560WA
Entry
CAALFM_C302560WA  CDS       T00189                                 
Symbol
DDC1, CaO19.245
Name
(RefSeq) Ddc1p
  KO
K06663  DNA damage checkpoint protein
Organism
cal  Candida albicans
Pathway
cal04111  Cell cycle - yeast
cal04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CAALFM_C302560WA (DDC1)
   04113 Meiosis - yeast
    CAALFM_C302560WA (DDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cal03400]
    CAALFM_C302560WA (DDC1)
DNA repair and recombination proteins [BR:cal03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    CAALFM_C302560WA (DDC1)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 3638374
NCBI-ProteinID: XP_719944
UniProt: A0A1D8PJM0
LinkDB
Position
3:554571..556037
AA seq 488 aa
MVFEAEIGLNKHKLMWSKSIASLSNIAEAITFTINKDSISLSATNTSKTSYAQIYFKKTF
FNKLSVDFNNILPEGYDDGKQQKEEPSYSFLINSRHMATLFKSLDSSGMKHLSFRINWSR
NAPINSRYKLFIEIHTKKLVVKKFQASYTPANKQNLHIASIYKDTLYKQREEEEDLHDKT
RINHIMIDQLIPKQFLEMVPASAEDFKIDIKSERISFCGYTKQIIKDRDYLKQPMAVTVT
ISLDELTDSNLLSSNSDQEPIRKQINFGMRDFKNFLNLANFFTTPSSSSERLDENYVTTA
NNDYFHIFFRNPGDPILFDLQNYQHTEVQFIQITSEDKSELHSKEIDAELIRKGLTIEAP
IPQKIQSNETATTTASTSTTKTKTTTPSLTRLTTNTVFGKPSITKKRGKHRLINKDQVSQ
GTINDDFDDGVTYGQEPEPERDRDRANYAETDYSNSSEDESKEPPFKKHAFDEELGPTQL
NNKPKSIF
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggtatttgaagcagaaattggactcaataagcataaacttatgtggtctaaatccata
gcatccctatcaaatatagcagaagcaataacgttcactataaataaagattctatatcc
ttgtctgcaaccaataccagtaaaacctcctacgcgcaaatatatttcaagaaaaccttt
ttcaacaaactttccgttgattttaataatatattaccagaaggatatgatgatgggaaa
caacagaaggaggaaccgagttattcttttcttattaattcacgacatatggcaacttta
tttaaaagtctagattcaagtggtatgaaacatttaagttttaggataaattggtctcgt
aatgcaccaataaatctgaggtataaattatttattgaaatccatacgaaaaagttggtt
gttaaaaagttccaagctagttatactccagcaaataaacagaatctacatattgcttct
atttataaggacaccttatataaacaacgagaagaagaagaagatttacatgataaaact
cgaatcaaccacataatgatagatcaattgatacccaaacagtttcttgaaatggtccct
gcatctgctgaggatttcaaaatagatatcaagagtgaaagaatactgttttgtggttat
actaaacaaataatcaaagatagagattatttaaaacaacccatggcagtaacagtaact
atcagtctagacgaattaactgattccaatttactactgtcgaattcagatcaagaacct
atacgaaaacaaattaattttggcatgcgtgatttcaaaaattttttgaatttagccaat
tttttcacaactccatcatcatcctctgaacgattagatgaaaattatgtaactactgcc
aataatgattatttccacatattcttcagaaaccctggagatcctatattatttgattta
caaaattaccaacatacagaagttcaattcattcaaatcacttctgaggataaatctgag
ttacattcaaaagaaattgacgcagagttgattagaaaaggtttaacaatagaagcccca
ataccccaaaaaattcaaagtaacgaaacagcaacaactacagcaagcacaagcacaaca
aaaacaaaaacaacaaccccatcattgactagactcaccactaatactgtatttggtaaa
ccttctattacaaagaaaagaggaaaacataggcttatcaataaagatcaagtatctcaa
ggaacaataaatgatgattttgacgatggagttacatatggacaagaaccagaaccagaa
agagatagagatagagccaattatgctgaaaccgattacagtaatagttccgaagatgaa
tctaaagagccaccatttaaaaaacatgcatttgatgaagaacttggtcctacacaactc
aacaataaacctaaatcaatattttga

DBGET integrated database retrieval system