Citrobacter amalonaticus Y19: F384_23995 Help Entry F384_23995        CDS       T03934                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism cama  Citrobacter amalonaticus Y19 Pathway cama02024   Quorum sensing cama03018   RNA degradation Brite KEGG Orthology (KO) [BR:cama00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     F384_23995 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     F384_23995 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cama03019]     F384_23995 (hfq)    03036 Chromosome and associated proteins [BR:cama03036]     F384_23995 (hfq) Messenger RNA biogenesis [BR:cama03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      F384_23995 (hfq) Chromosome and associated proteins [BR:cama03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     F384_23995 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AKE61413 UniProt:  A0A0F6RI20 LinkDB All DBs Position 5142191..5142499 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQGSTAQQDSEETE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggtcaaatcgagtcttttgat cagtttgtgatcctgttgaaaaacacggtcagccagatggtttataagcacgcgatttct actgttgtcccgtctcgcccggtttctcatcacagtaacaatgccggtggcggtaccagc agtaactatcatcacggtagcagcgcgcagggttctactgcgcaacaggacagcgaagag accgaataa

DBGET integrated database retrieval system