Cobetia amphilecti: LCW13_05455 Help Entry LCW13_05455       CDS       T07922                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism camh  Cobetia amphilecti Pathway camh02024   Quorum sensing camh03018   RNA degradation Brite KEGG Orthology (KO) [BR:camh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     LCW13_05455 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     LCW13_05455 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:camh03019]     LCW13_05455 (hfq)    03036 Chromosome and associated proteins [BR:camh03036]     LCW13_05455 (hfq) Messenger RNA biogenesis [BR:camh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      LCW13_05455 (hfq) Chromosome and associated proteins [BR:camh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     LCW13_05455 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UBU49704 LinkDB All DBs Position 1285830..1286078 Genome browser AA seq 82 aa AA seqDB search MSKGQSLQDPYLNILRKERIPVSIFLVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAIS TVVPSRNVRLPAQDPSVPSTES NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccaaaggtcaatcactccaggacccgtacctgaacatcctgcgcaaggaacgtatc ccggtctcgatcttcctggtcaacggcatcaagctgcagggccagatcgaatccttcgat cagttcgtgatcctgctgcgcaatactgtctcccagatggtttacaagcacgctatctcg accgtggtgccgtcgcgcaatgtgcgcctgccggcccaggatccgagcgtgccgtccaca gaaagctga

DBGET integrated database retrieval system