KEGG   Capsicum annuum (peppers): 107840093
Entry
107840093         CDS       T04646                                 
Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic isoform X1
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
cann  Capsicum annuum (peppers)
Pathway
cann00902  Monoterpenoid biosynthesis
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    107840093
Enzymes [BR:cann01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     107840093
    4.2.3.16  (4S)-limonene synthase
     107840093
    4.2.3.105  tricyclene synthase
     107840093
    4.2.3.117  (-)-camphene synthase
     107840093
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 107840093
NCBI-ProteinID: XP_016539309
UniProt: A0A1U8E663
LinkDB
Position
8:162714901..162718029
AA seq 615 aa
MVAMTIFSTRHLPTPFSSFIPPKAFKSKSCSLSTTDMKTGSLVPLNHSHNLSTNLSFSGG
VNNPSRRSGNYEPTMWNYEFIQSTHNCYVGEKYMKRFDELKKEVKKNLMMVEGSHELDKL
ELIDNLERLGVSYHFKDEIMHILKSINQHTAPGDSLYATALKFRLLRQHGFHISQDILND
FKDEQGNLKQCLCEDIQGLLQLYEASFLSTDTETATLMESANTFSMSHLKNYLQNRSNLN
GDHQDNRTVELVRHALELPLHCMMLRVETRWYINIYEKMENADPLLLELAKLDYNIVQAT
HQQDLRNLSRWWKNSCLAEKLSFTRDRIVEAFLWIAGMMFEPQKNQNCRIMLAQVTAMAT
VIDDIYDVYGTLDELELFTRAVERMEIDAMDELPDYMKVCYLALFNTTTEIAYHVLKDQG
INAMPYLTKSWADLCKAYMQEARWYYNGYTPSVEEYMENAWISVGSLVMVVNAFFLVTNP
ITKEALEYVFLSKYPDIIRWSATIIRLADDLATSSDEMERGDVSKLIQCYMNEKGASEEE
ARKHVNFMINETWKLINTAQRDNSLLSEKFIGCAINVARTGQTIYQHGDGHGIQNSEIQN
RISKLFFEPITISIP
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggtagccatgacaatattttccacaagacatttacctacccctttttcatctttcatt
ccaccaaaggcatttaaatcaaaatcctgcagcctctctactactgacatgaaaactgga
tcactagtacctcttaatcactctcataatctttccactaatctttcattttcaggtgga
gttaataaccctagtaggcgttcagggaattacgagcctaccatgtggaattatgaattt
attcagtctacacacaattgttatgtgggagagaagtatatgaagcgatttgacgaactg
aaaaaggaagttaaaaagaatttgatgatggttgaggggtcacatgaattagacaagttg
gagttgattgataatttggaaaggcttggtgtgagttaccatttcaaggatgaaatcatg
catatattgaagagcataaaccaacacactgctccaggagattcactatacgccactgct
ttgaaatttaggctcttgagacaacatggttttcatatctctcaagacatactgaatgat
ttcaaagatgagcagggtaacttaaagcaatgtctttgtgaagatatacaagggttgtta
cagttatatgaagcttcatttctctctacggatactgaaaccgctactctaatggagtcg
gccaatacattctcaatgtcacatctaaagaattatttgcagaataggagtaatttaaat
ggtgatcatcaagacaatcggacagtggaactagtacgccatgccctggaacttcctttg
cattgcatgatgttgagagtagagacaaggtggtatattaacatttatgagaaaatggaa
aatgctgatcctcttctgcttgagcttgctaagttggattacaatattgtgcaagcaaca
caccaacaagatttaagaaatctctcaagatggtggaagaactcatgcctagcagaaaaa
ttgtcatttacaagggatagaatagttgaagctttcttatggatagctgggatgatgttt
gaacctcaaaagaaccaaaattgccgaataatgttggcacaggtcactgctatggctaca
gtcatagatgacatttatgatgtttatggcacacttgatgagttggagctcttcactcgt
gctgttgaaagaatggagattgatgcaatggatgagcttccagattatatgaaagtatgt
taccttgcactcttcaacactaccactgaaattgcatatcatgttctcaaagatcaaggg
atcaacgccatgccctacctcacaaaatcatgggcagatttgtgcaaagcttacatgcaa
gaagcaaggtggtactacaatggatatacaccaagtgtggaagaatacatggaaaatgca
tggatttcagttggaagtctagtgatggtagtgaatgcattcttcctagttacaaatcca
attaccaaagaggcattggaatacgtctttttaagcaagtacccagacataattcgttgg
tctgctacaattattcgtcttgctgatgatctagcaacatcatctgatgaaatggaaaga
ggtgatgtttccaagttaattcaatgttacatgaatgagaagggtgcttctgaagaagag
gcaagaaaacacgtcaattttatgataaatgagacatggaaactgatcaacacagctcaa
cgggataattcattactatctgaaaaattcattggatgtgctataaatgttgccagaaca
ggacaaaccatttaccagcatggagatggccatggaattcaaaattctgagattcaaaat
cgtatatccaaattatttttcgaacccatcacaatttcaattccataa

DBGET integrated database retrieval system