Magallana angulata (Portugese oyster): 128183590 Help Entry 128183590         CDS       T09348                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism canu  Magallana angulata (Portugese oyster) Pathway canu00510   N-Glycan biosynthesis canu00513   Various types of N-glycan biosynthesis canu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:canu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     128183590    00513 Various types of N-glycan biosynthesis     128183590  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     128183590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB TMEM141 DUF7027 DUF7318 Motif Other DBs NCBI-GeneID:  128183590 NCBI-ProteinID:  XP_052708644 LinkDB All DBs Position 5:25180945..25185743 Genome browser AA seq 82 aa AA seqDB search MADMTVEMMSRYVSPINPAVFPHLTVVLLGIGIFFMAWFFVYEVTSNKFTRDLSKELLVS LVASVFMGFGVVFLLLWVGIYV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcagacatgacagtggagatgatgagtcggtacgtcagtcccatcaacccggcggtg ttcccacacctgaccgtcgtgctgctgggaatcggcatcttctttatggcctggttcttt gtctatgaagtaacctccaacaaattcactcgggacctctccaaggagctcctggtctct ctggtcgcctcggtgtttatgggctttggtgtggtcttcttattgctgtgggttgggatt tatgtatag

DBGET integrated database retrieval system