KEGG   Cercocebus atys (sooty mangabey): 105575364
Entry
105575364         CDS       T07242                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty04927  Cortisol synthesis and secretion
caty04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:caty00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    105575364 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105575364 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 105575364
NCBI-ProteinID: XP_011892453
Ensembl: ENSCATG00000042418
UniProt: A0A2K5NQ06
LinkDB
Position
Unknown
AA seq 172 aa
MANGTNASTPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVLLLFLILLYM
SWSGSPQMKNSPKHHPTCPWSHSLSLQLCIQKCLPCHREPLGTSRAQASSVEPGSRTDPD
QLLRQESSSTLPLGVFQTHPTLLWELTLNGGPLGRSKPSEPPPGDGTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctaccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gccttctgggtgagcctggctgccttcgtgctgctcctcttcctcatcctgctttacatg
tcctggtcgggctccccgcagatgaagaacagccccaagcaccacccaacatgcccctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggggacctcacgggctcaggcgagttcagtggagccagggagcagaactgaccctgac
cagctgctacgacaggagagctcctccaccttgccccttggggttttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcggcagaagcaagcccagcgag
cctccccctggagacgggacctctcaattgcagagctga

DBGET integrated database retrieval system