KEGG   Cercocebus atys (sooty mangabey): 105599647
Entry
105599647         CDS       T07242                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty04610  Complement and coagulation cascades
caty04810  Regulation of actin cytoskeleton
caty05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:caty00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105599647 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    105599647 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105599647 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:caty04515]
    105599647 (ITGAX)
   04090 CD molecules [BR:caty04090]
    105599647 (ITGAX)
Cell adhesion molecules [BR:caty04515]
 Integrins
  Integrin alpha subunits
   105599647 (ITGAX)
CD molecules [BR:caty04090]
 Proteins
  105599647 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 105599647
NCBI-ProteinID: XP_011945411
Ensembl: ENSCATG00000032947
LinkDB
Position
Unknown
AA seq 1154 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLATTTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTRRLPASGQECPRQELDIVFLIDGSGSISSDNFATMMNFVRAVINQ
FQRPSTQFSLMQFSSQFSVHFTFEKFRRTSNPLDLLASVHQLTGFTHTATAIQKVVRELF
QASHGARGDATKILIVITDGRKEGDSLDYKDVIPMADAAGIIRYAIGVGSAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELALWKGVQNL
ILGAPRYQHTGKAAIFTQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGALGPSIGPSHSQRIAGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQALLLRTRPVLGVRVSMQFKPAEIPRSAFECREQMVSDQILGQSSICLYIDK
RSKNLLGSRDLQSSLTVDLALDPGRLSPRATFQETKNRSLSRVQVLGLETYCETFTLLLP
TCVEDSVTPITLRLNFTLVGEPLPAFRNLQPMLAADAQRYFMASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRHVAEGQKQGQ
LRSLRLTCDSAPAGSQGTWTTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLALPLKYAVYTVASSHEQSTKYLNFSDSEEKENRVAVHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFHCDIPSFSIQEELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTMLEKYEIHNPTPLIVGSSIGGLLLLALITAALYKVGFFKRQYKQM
MEEANGQIAPENGT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccgcaagagagaacagctgcc
aaccaaacgggcggcctctaccagtgcggctacagcaccggtgcctgtgagcccattggc
ctgcaggtccccccggaggccgtgaacatgtccctgggcctgtccctggcgactaccacc
agccccccccagctgctggcctgcggccccaccgtgcaccacggatgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccggaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcctccgacaactttgccacgatgatgaacttcgtgagagctgtgataaaccag
ttccagagacccagcacccagttttccctgatgcagttctccagtcaattctccgtacac
ttcactttcgagaaattcaggcgcacctcaaaccccctcgacctgttggcttctgttcac
cagctgacagggttcacacacacggccactgccatccaaaaagtcgtgcgcgaattgttc
caggcctcacatggggcccgtggagatgccaccaaaattctcattgtcatcactgacggg
aggaaagaaggtgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggatcagcttttcaaaacagaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagtagctccttcgaattggagatggcgcaggagggcttcagcgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggctctctggaaaggggtgcagaacctg
atcctgggggccccccgctaccagcacaccgggaaggctgccatcttcacccaggtgtcc
gggcaatggaggttgaaggccgaagtcacggggacgcagatcggttcctacttcggggcc
tccctctgctctgtggatgtggacggcgatggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctccacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccggggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcgccggctcccagctctcccccagg
ctgcagtattttgggcaggcgctgagcgggggtcaggacctcacgcaggatggactggtg
gacctagctgtgggggcccgaggccaggcgctcctgctcaggacgagacctgtgctcggg
gtgcgggtgagcatgcagttcaaacctgcggagatccccaggtctgcatttgagtgtcgg
gagcagatggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaaa
cgttccaagaacctgcttggcagccgtgacctccaaagctctctgaccgtggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccgtagtctg
agccgagtccaagtcctcgggctggagacatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctccctgccttcagaaacctgcagcctatgctggccgccgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcctgaagaccctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgccacgtggcagagggccagaaacaggggcag
ctgcgttccctgcgtctgacatgtgacagcgccccagctgggagccagggcacctggact
accagctgcagaatcaaccacctcatcttccgtggtggcgcccagatcacctttttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggcgctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagaaccgtgtggccgtgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatccctgcggtgctcctca
gagaaaattgcacccccagcgtctgacttcctggcacacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccactgtgacatcccctccttcagcatccag
gaggagctggatttcaccctgaagggcaacctcagttttggctgggtccgccagacatcg
cagaagaaggtgtcggttgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacgatgctggagaagtac
gagatccacaaccccacccccctcatcgtaggcagctccattgggggtctgctgctactg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaagcaaatg
atggaggaggcaaatggacaaattgctccagaaaacgggacatag

DBGET integrated database retrieval system