Carassius auratus (goldfish): 113105290 Help Entry 113105290         CDS       T07313                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism caua  Carassius auratus (goldfish) Pathway caua04060   Cytokine-cytokine receptor interaction caua04218   Cellular senescence caua04620   Toll-like receptor signaling pathway caua04621   NOD-like receptor signaling pathway caua04622   RIG-I-like receptor signaling pathway caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113105290  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113105290  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113105290    04621 NOD-like receptor signaling pathway     113105290    04622 RIG-I-like receptor signaling pathway     113105290  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113105290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caua04052]     113105290    00536 Glycosaminoglycan binding proteins [BR:caua00536]     113105290 Cytokines and neuropeptides [BR:caua04052]  Cytokines   Chemokines    113105290 Glycosaminoglycan binding proteins [BR:caua00536]  Heparan sulfate / Heparin   Chemokines    113105290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  113105290 NCBI-ProteinID:  XP_026122128 Ensembl:  ENSCARG00000004880 UniProt:  A0A6P6NFI0 LinkDB All DBs Position 7:11468310..11469923 Genome browser AA seq 98 aa AA seqDB search MMKFSTSAFMLLICTAALLSTTEGAKQIQLRCECIKTHSDPIPFKLIQSLRVNEAGPHCK NEEIIATMKKGTTCLNPAKDWVISLKEKFNKKNVKSQN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgaagttcagcacatctgccttcatgcttctgatctgcacagctgcactgctgtcc acaacagagggagctaaacaaatccagctacgctgtgagtgtattaaaacacattcagac ccaatcccattcaaactaatacagtcactgagggtgaatgaagctggaccacactgcaaa aatgaggagatcattgccacaatgaagaaaggaacgacatgtcttaatcctgcaaaagac tgggtgatttctctcaaggaaaaattcaacaagaagaatgtcaagagtcaaaactga

DBGET integrated database retrieval system