KEGG   Carassius auratus (goldfish): 113115338
Entry
113115338         CDS       T07313                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
caua  Carassius auratus (goldfish)
SSDB
Motif
Pfam: MRAP LapA_dom DUF4407
Other DBs
NCBI-GeneID: 113115338
NCBI-ProteinID: XP_026138639
Ensembl: ENSCARG00000042800
UniProt: A0A6P6QYT4
LinkDB
Position
15:20084609..20085550
AA seq 91 aa
MKNSTESSSEYVWDYEYYYDYIDPVSVNASALKYNRYSVVIIFWIILAAFIGFFFLILSL
ISHSRQLPRGPRVQKSGLPLMKSYGSPQKRN
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaaaactccacagagtcgtcttcagagtatgtgtgggattacgagtactactatgat
tacatcgatccggtctccgtcaacgccagtgctctcaagtacaacagatattcagtcgtc
ataatattctggatcattctagctgcattcattgggtttttcttcttgattttgtcactt
atatcacactcaaggcaacttccgagaggccctcgtgtccaaaaatctgggttgccattg
atgaaaagctacgggtctcctcagaaacgaaactaa

DBGET integrated database retrieval system