KEGG   Candida auris: CJI97_000412
Entry
CJI97_000412      CDS       T04850                                 
Name
(RefSeq) uncharacterized protein
  KO
K06663  DNA damage checkpoint protein
Organism
caur  Candida auris
Pathway
caur04111  Cell cycle - yeast
caur04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:caur00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CJI97_000412
   04113 Meiosis - yeast
    CJI97_000412
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:caur03400]
    CJI97_000412
DNA repair and recombination proteins [BR:caur03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    CJI97_000412
SSDB
Motif
Pfam: Rad9 Rad1
Other DBs
NCBI-GeneID: 40025559
NCBI-ProteinID: XP_028892803
LinkDB
Position
Unknown
AA seq 437 aa
MSFVAAIDSSKNISVWSRAVNALAQVSDQIKFTITATGLTLSAVNPSRTSHGDISFQKHF
FREFSFDTANIMVSGFRAGELDPNASSYSCIVSTKHMVVLFKNLDAGGLSYICLRFDCHQ
NVPRNKEFRILVEILTRKMIVKKYSMNYQPVLPQEVLIPRLYKKDYDLGRCKHLKMETGT
MKSFLDIVPVSTEDFMIDVKLTKISFVAHTKQVVKDRELLKQPMSITISMSIDELMESNL
DGVTASINFRLKDFRTFITCCASMRDMAHYDDDLLPEASFEAYFKGNGNPVVLEHTSGPV
TATLVLITASAGEPLENDDNRDKYVLHGHAIQRAPEREIPEPVRHKNASASGRLTNIGIP
PRREPSIEPDSNHSFQTSSMGDIVTYGKRGSTPVEIPHKRAKVLDGDTDYSTSGEDDGGE
QVFGPTQHNNKPTSLFE
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtcatttgtcgccgctatagacagctccaaaaacatcagcgtgtggtctcgtgcggtc
aatgcattggcccaggttctggaccaaatcaagttcaccatcaccgcaactggcctaacg
cttctggcggtgaacccgtcaagaacaagccatggagacatttcgtttcaaaagcacttt
tttcgggaatttctgtttgacacggcaaacatcatggtttctggctttcgtgctggcgag
ctagacccaaacgctctgtcgtactcatgcattgtgtctacaaagcacatggtggtgctc
ttcaagaacctagacgctggagggctcagttacatctgccttcggttcgactgccaccag
aacgttccaagaaacaaggagttcaggatattggtcgagatcttgacgcggaagatgatt
gtcaaaaaatacctgatgaactaccagccggtgctaccgcaggaagtgcttattccacgc
ttgtacaagaaggactacgatttgggaaggtgcaaacacctaaagatggagacgggcacc
atgaagtcgtttcttgatattgttcctgtgtccacggaggatttcatgatcgatgtgaag
ctaaccaagattctgttcgtggctcacactaagcaggtggtgaaggaccgggagttgttg
aagcaacccatgctgataacgattctgatgagtatcgacgagttgatggagctgaacttg
gacggggtcactgcgtcaatcaacttccgtctcaaggacttccgtacttttatcacctgc
tgcgcttcgatgcgagatatggcccactacgacgatgacttgctacccgaagcgctgttt
gaggcgtacttcaaggggaatggaaaccccgtagttctagagcacacgtcagggccggtt
acagctactcttgtcctaattaccgccagtgcgggcgagccactagagaatgatgataat
cgtgacaagtatgttcttcacgggcatgccatacagcgggctcccgagagagagatacca
gagcctgttagacataaaaatgcatctgcatctggccgtctcacgaatatcgggattcct
cctcggcgagaaccgagcattgagcctgattccaaccactcgtttcaaacaagctccatg
ggtgacattgtcacctacggaaagcgcggctcgacccctgtggaaattccacacaagaga
gctaaagttctcgatggagacactgactacagcacatccggtgaggacgatggcggtgag
caggtgtttggccctactcagcacaacaacaagcctacatcgttgttcgaatga

DBGET integrated database retrieval system