Corylus avellana (European hazelnut): 132176129 Help Entry 132176129         CDS       T09426                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism cave  Corylus avellana (European hazelnut) Pathway cave03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cave00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     132176129  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cave03400]     132176129 DNA repair and recombination proteins [BR:cave03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      132176129 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  132176129 NCBI-ProteinID:  XP_059444240 LinkDB All DBs Position ca3:complement(5543398..5545332) Genome browser AA seq 104 aa AA seqDB search MEDETTFDPDLIHAIFKLVWTRRALERQKNEGADALDFQVGAGTSKKNRPTYANANALKL SCELLRVFITEAVQRAATIAEAEGVSKIEATHLERILPQLLLDF NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggaggacgagaccaccttcgatcctgatctgattcatgccattttcaagctcgtgtgg accagaagagccctcgagcgacaaaaaaacgaaggcgccgatgctttggatttccaggta ggagctggaacatccaagaagaaccggccgacttacgccaatgcaaatgcactaaagctg agttgtgaacttcttcgtgtctttatcacagaggccgtgcagcgtgctgctacaattgct gaagctgagggtgttagtaaaattgaagcaactcatttggagaggattctcccgcagtta cttctggatttttaa

DBGET integrated database retrieval system