KEGG   Camelus bactrianus (Bactrian camel): 105070409
Entry
105070409         CDS       T07534                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cbai  Camelus bactrianus (Bactrian camel)
Pathway
cbai04927  Cortisol synthesis and secretion
cbai04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cbai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    105070409 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105070409 (MRAP)
SSDB
Motif
Pfam: MRAP AIMP2_LysRS_bd DUF4131 bCoV_NS7B
Other DBs
NCBI-GeneID: 105070409
NCBI-ProteinID: XP_010955141
LinkDB
Position
Unknown
AA seq 143 aa
MANRTNASAAYYSYEYYMDYLDLIPVDEKKLKANKHSIVIAFWVSLAAFVLFLFLILLYM
SWSGPSQTRNSTQRHSMCRWSLSLNLPLCVWRHCLCHRAPQGTPQPPPREGEESSSTSPP
TTPQAPTALLWELALDADSHGIR
NT seq 432 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaacgcctccgccgcgtactacagctacgaatactacatggactac
ttggacctcattcctgtggatgagaagaagctgaaagccaacaaacactcgatcgtcatc
gccttctgggtgagcctggctgctttcgtgctgtttctcttcctcatcctgctctacatg
tcctggtcaggcccctcgcagaccaggaacagcacgcagcgccactccatgtgccgctgg
agtctcagtctcaacctcccgctctgcgtctggaggcactgcctgtgccacagggccccc
caggggaccccgcagcctccacccagggagggtgaggaatcatcctccacctcgcccccc
accaccccccaggcccccaccgctctcctctgggaactggccctcgacgcggactcgcac
ggcatccgctga

DBGET integrated database retrieval system