KEGG   Camelus bactrianus (Bactrian camel): 105070958
Entry
105070958         CDS       T07534                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
cbai  Camelus bactrianus (Bactrian camel)
Pathway
cbai04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cbai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105070958 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cbai04050]
    105070958 (TNFRSF8)
   04090 CD molecules [BR:cbai04090]
    105070958 (TNFRSF8)
Cytokine receptors [BR:cbai04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   105070958 (TNFRSF8)
CD molecules [BR:cbai04090]
 Proteins
  105070958 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 105070958
NCBI-ProteinID: XP_010955820
LinkDB
Position
Unknown
AA seq 493 aa
MFCETLVINSCARCFPHSVCPAGMVVKVQGTAQRDTVCELPSLGAGPDCSTSPHGCPGPV
SRTTHQAKPTLTSPASSDTRTTLLGGGTPIAPEDASEMTPSSPSIVGKLNPDGGLSLQQP
CPQGSADCRKPCEPNYYLDRDGRCTACVSCSGDDLVEKIPCTWNSSRVCECRPGMFCVTS
ATNSCARCVARPICPPGMVAKLQGMAEGDTTYELPPPGTYPDCSSNPEDSGAPASTDPSL
ISLVDSLTGREHGGGVTHAWGDASMSTSAPISFSSTGKPTLVSGPVLFWVTLTLVVVVSS
GSFLLCHWKACRKWIRQKLHLCYSVQTFQPKLEPADSRPGRNPALIRSISVAEPGTEELG
LLSPQAAEMCPTVGAAGLESLRLLEASPASSPSSPTDLPEPRGTTECTNNRIENIYIMKA
DTVIVGTVKTEVPEGQGLVGPAGSEFEEGLEVDYAPHYPEQETEPPLGSCGDVMFSVEEE
GKEDPLPTTDSGK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgttctgtgagacattagtcatcaactcctgcgcccgctgcttcccgcactccgtctgc
ccagcaggcatggttgtcaaggtccagggcacagcacagagggatactgtctgtgagctg
ccttccctgggggccggccctgactgcagcaccagcccacacggctgcccgggacccgtc
agccgcaccacccaccaggccaagcccaccttgacctccccagcaagctctgataccagg
accacacttcttggaggaggcacccccatcgccccagaagatgcatctgaaatgactccc
agctctccctccatcgtggggaagctcaatccagatggagggctgagcctgcagcagccg
tgccctcaggggtccgccgactgcaggaagccatgtgaacccaactactacctggacagg
gatggccgctgcacggcctgtgtgagctgttcaggagatgacctcgtggagaagatacct
tgcacgtggaactcctcccgtgtctgcgagtgtcgacctggcatgttctgtgtcacgtca
gccaccaactcttgtgcccgctgcgtcgcccgtcccatctgcccaccagggatggtcgcc
aaactccagggtatggctgagggggacaccacctacgagctacctcccccggggacctac
cctgactgcagctccaacccagaggacagcggggcccctgccagcaccgacccctccctg
atctccctggtggactccctgacgggtagggagcatggagggggcgtaacccacgcctgg
ggggatgcctccatgtcaaccagtgcgcccatctccttctcctccacagggaagcccact
ctggtttcaggacccgtgctcttctgggtgaccttgacgctggtggtggtcgtcagctcc
ggctccttcctcctgtgccactggaaagcctgcaggaagtggattcggcaaaagctccac
ctgtgctactccgtccagaccttccagcccaagctggagcctgcagattccaggcccggg
aggaaccctgcactgatcaggagcatatcggtggcagagccgggcacagaggagctgggg
ttgctgagcccccaagctgcagagatgtgccccaccgtgggggcagctggcctggagagc
ctgcggctgctggaggccagcccggccagcagcccttcatcccccaccgaccttcctgag
ccccgggggaccacggagtgtaccaacaacaggatcgaaaacatctacatcatgaaggct
gacaccgtgatcgtggggacggtgaagaccgaagtgcccgagggccagggcctggtgggg
ccggcggggtctgagtttgaggagggtctggaagtggactatgccccccactaccccgag
caggagacagaaccacctctgggcagctgcggggacgtcatgttctcagtggaggaggaa
ggaaaggaagaccccttgcccacgaccgactctgggaaatga

DBGET integrated database retrieval system