KEGG   Camelus bactrianus (Bactrian camel): 105082772
Entry
105082772         CDS       T07534                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
cbai  Camelus bactrianus (Bactrian camel)
Pathway
cbai04610  Complement and coagulation cascades
cbai04810  Regulation of actin cytoskeleton
cbai05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cbai00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105082772 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    105082772 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105082772 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cbai04515]
    105082772 (ITGAX)
   04090 CD molecules [BR:cbai04090]
    105082772 (ITGAX)
Cell adhesion molecules [BR:cbai04515]
 Integrins
  Integrin alpha subunits
   105082772 (ITGAX)
CD molecules [BR:cbai04090]
 Proteins
  105082772 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha FG-GAP_3 DUF2785
Other DBs
NCBI-GeneID: 105082772
NCBI-ProteinID: XP_010970712
LinkDB
Position
Unknown
AA seq 1216 aa
MHLSSQLPSRLRSRAISSRKPSWKSTPFQHSGSRIGLGAPKPMFDTPVMPKTGIFLLLLM
ALPSSLCFNLEMDKPTTFSMDSAGFGHSVVQYANWVVVGAPQEIKAANQTGGIYQCDYST
GMCKAIHLQVPPEAVNMSLGLSMAATTNPTQLLACGPTMHRACRENMHLTGFCFLLVSPS
WHAQRIPTALQECPKQEQDIAFLIDGSGSISFRDFAKMLNFVRAVMSHFQRPSSQFSLMQ
FSNKFVVHFTFKDFAISSDPLSLLNSVTQLRGYTHTATAIGMVTDQLFSASKGSRKDASK
ILIVITDGYKTGDYQDYKDVIPRAEAAGIIRYAIGVGSAFQTARSLQELQDIASKPSSEH
IFKVENFDALRDIQNQLKEKIFAIEGTQTTSSSSFELEMAQEGFSAVFTPDGPVLGAVGS
FSWSGGAFLYPPKMSPTFINMSQENGDMRDSYLGYSTELALWKGVQNLVLGAPRPPXAGR
EVLVAGESGTWPRRGPLARAGRMTPGSALQIGSYFGASLCSVDVDRDGSSDLVLIGAPHY
YEQTRGGRVSVCPLPKGWAKWQCGVILHGEQGHPWSRFGAALTVMGDVNGDKLMDVAIGA
PGEQENHGAIYLFHGTSGLSINPSYSQRIAGTQLSPRLQYFGQSLSGGQDLTQDGLVDLA
VGARGHALLLRTRPVLRVQATIRIFPAEVARSLFECQQHVASVQALGSATVCLHIHGSPK
NRLGDLKSSVTFDLTLDPGRLSPRAIFEETNTWNLTRVRVLGLTEHCEAVRLLLPACVED
SVTPIILRLNFSLVGKHVSSFGNLQPVLAVDAQRYFTASLPFEKNCGANHVCEDDLSISF
GVSGLKTLVVGSNLELNLEVTVRNDGEDSYGTRVTFFYPPGLSYRRVAVGQNQLQSRALR
LTCDSAPARSQDTISTRCSITHLIFREGAEITFMATFDVSPTAVLGDRLLLTANVSSENN
TPRTSKTTFQLEIPVKYAVYTVISSHEESTKYLNFSASEEKDSRGAQHRYQVNNLGQRDL
PASIDFSVPVKLNRVAVWKDVEVFHPQNPFIQCSSERIVHRESDFLTHFQKNPVLDCSIA
DCLRFRCDIPSFGVQEELDFILKGNLSFDWVSQTLQKKVVVVSVAEITFDRSVYSQLPGQ
EAFLRAQTELVLEKYEVHNPGPIIVGSTVGGLLLLALITAVLYKVGFFKRQYKEMMEEAN
GQTVPENGTADTQAAQ
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgcacctctctagtcagttgccttcaagactcagatcaagggccatctcctccaggaag
ccttcctggaaatctacacccttccaacatagcggctcccgcattggcttgggtgctccg
aagcctatgtttgacactccagtcatgcccaagactgggatcttcctcctcctgctgatg
gccttgccttcctctctctgcttcaacttggaaatggacaagccgaccaccttcagcatg
gacagtgctgggtttggacacagcgtggtccagtacgccaactgggtggtggttggggcc
ccccaggagataaaggctgccaaccaaacaggtggcatctaccaatgtgactacagcaca
gggatgtgtaaggccatccacctgcaggtgcccccagaggctgtgaacatgtccctgggc
ttgtccatggcggccaccaccaaccccactcagctgctggcctgtggccccaccatgcac
cgtgcatgcagggagaacatgcacctgacggggttctgcttcttgctggtctccccatcc
tggcatgcccagaggatccccactgccctgcaggagtgcccaaagcaggagcaggacatc
gccttcctgattgacggctcaggcagcatctccttcagagattttgccaaaatgctgaac
ttcgtgagggctgtgatgagccacttccagagaccgagctcccagttctccctgatgcag
ttctccaacaagtttgtggtgcacttcactttcaaagactttgcaatcagctcagaccca
ctaagcctgctgaattctgtaacgcagctgcgagggtacactcacacggccacagccatc
ggaatggtcacagaccaattgtttagcgcctcaaaagggtcccgaaaagatgcctccaag
atcctgatcgtcatcaccgatgggtacaaaacaggggactaccaggattacaaggatgtc
attcccagggctgaggccgctggcatcatccgctatgcaattggggtgggatcggctttt
caaactgcacgttccttgcaagaattacaggacattgcatcaaagccgtccagtgaacat
atatttaaagtagagaattttgatgctttgagagacattcaaaaccaactgaaagagaag
atctttgccatcgagggtacacagaccacaagcagtagctccttcgaattggagatggcc
caggagggcttcagtgctgtgttcacgcctgatggaccagttctgggggctgtggggagc
ttcagctggtctggaggggccttcctgtacccccccaaaatgagccccaccttcatcaac
atgtcccaggagaacggggacatgagggactcttacctgggttactccactgagctggcc
ctttggaagggggtacagaacctggtcctgggggccccccggcctcctnnggcggggagg
gaggtgctggtggctggggagagcgggacctggcccagaaggggtcctctggcaagggca
ggcaggatgactccgggctctgccctgcagatcggctcctatttcggggcctccctctgc
tccgtggacgtggacagagatggcagctccgacctggtcctcatcggggccccgcattac
tatgagcagacccgggggggccgggtgtccgtgtgccccttgcccaaggggtgggctaag
tggcagtgtggggtcattctccatggggagcaaggccacccctggagccgctttggggca
gccctgacagtgatgggggatgtgaatggggacaagctgatggacgtggccatcggggcc
ccaggagagcaggagaaccatggtgccatctacctgtttcatggaacctcaggactgagt
atcaacccctcatacagccagaggattgcaggtacccagctctctcccaggcttcagtat
tttgggcagtcactgagcgggggtcaggacctcacccaggatggactggtggacttggct
gtgggggcccggggacatgcgctactgctcaggaccagacctgtgctcagggtgcaggca
accattcgcatctttccggcagaggtcgccaggtctctgtttgagtgccagcagcacgtg
gcctctgtccaggctctgggtagtgccactgtctgccttcatattcacggaagtcccaag
aacaggctgggtgacctcaaaagctctgtgacctttgaccttaccctcgatcctggccgc
ttgagccctcgtgccattttcgaggagacaaatacctggaatctgactcgtgttcgagtc
ctggggctgacagagcactgcgaggctgtgaggctgctccttccggcttgtgtggaagac
tcagtgacccccatcatcttgcgtctcaacttctccctggtgggcaagcacgtctcttcc
tttggaaacctccagcccgtgctggctgtggatgcccagagatacttcacggcttctctc
cccttcgagaagaactgtggtgccaatcacgtctgcgaggatgacctcagcatttccttt
ggggtctcgggcttgaagacgctggtggtggggagtaacctggagctgaacttggaagtg
acagtgcggaatgatggcgaggactcctatggaaccagagtcaccttcttctacccgcca
gggctgtcttaccgacgtgtagcagtgggccagaaccagctgcagtcacgcgccctgcgc
ctgacctgtgacagcgcccctgccaggagtcaggacaccatcagcacccgctgtagcatc
acccacctcatcttccgtgagggcgccgagatcaccttcatggccacctttgatgtctcc
cccacggccgtgctgggagaccggctgcttctgaccgccaatgtgagcagtgagaataac
actcccaggacaagcaagaccaccttccagctggagatcccggtcaagtacgctgtctac
accgtgatcagcagccatgaagagtccaccaagtacctcaacttctcggcctcagaggag
aaggacagccgtggggcccagcacagataccaggtgaacaacctgggacagagggacctg
cctgccagcattgatttctcagtgcctgtgaagctgaaccgggtggcagtgtggaaggat
gtggaggtcttccacccccagaacccgttcattcagtgctcttcagagagaatagtgcac
agagagtctgacttcctgacccactttcagaagaatcctgtgctggactgctccattgct
gactgcctgaggttccgctgtgacatcccctcctttggtgtccaggaggaacttgacttc
attttgaagggcaacctcagctttgactgggtcagccagacattgcagaagaaggtggta
gtcgtgagtgtggctgaaatcacatttgacagatctgtgtattcccagcttccaggacag
gaggcatttttgagagcccagacggagctggtgctggagaagtatgaggtccacaaccct
ggtcccattattgtgggcagcactgtgggaggactgctgctgctagctctcatcacagcc
gtactgtacaaggttggcttcttcaaacgtcagtacaaggaaatgatggaggaagcaaat
ggacagactgtcccagaaaacgggacagcagacacccaagctgcccaataa

DBGET integrated database retrieval system