KEGG   Cervus canadensis (wapiti): 122423876
Entry
122423876         CDS       T07554                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad01521  EGFR tyrosine kinase inhibitor resistance
ccad01522  Endocrine resistance
ccad04010  MAPK signaling pathway
ccad04012  ErbB signaling pathway
ccad04014  Ras signaling pathway
ccad04015  Rap1 signaling pathway
ccad04062  Chemokine signaling pathway
ccad04068  FoxO signaling pathway
ccad04071  Sphingolipid signaling pathway
ccad04072  Phospholipase D signaling pathway
ccad04137  Mitophagy - animal
ccad04140  Autophagy - animal
ccad04150  mTOR signaling pathway
ccad04151  PI3K-Akt signaling pathway
ccad04210  Apoptosis
ccad04211  Longevity regulating pathway
ccad04213  Longevity regulating pathway - multiple species
ccad04218  Cellular senescence
ccad04360  Axon guidance
ccad04370  VEGF signaling pathway
ccad04371  Apelin signaling pathway
ccad04540  Gap junction
ccad04550  Signaling pathways regulating pluripotency of stem cells
ccad04625  C-type lectin receptor signaling pathway
ccad04650  Natural killer cell mediated cytotoxicity
ccad04660  T cell receptor signaling pathway
ccad04662  B cell receptor signaling pathway
ccad04664  Fc epsilon RI signaling pathway
ccad04714  Thermogenesis
ccad04720  Long-term potentiation
ccad04722  Neurotrophin signaling pathway
ccad04725  Cholinergic synapse
ccad04726  Serotonergic synapse
ccad04730  Long-term depression
ccad04810  Regulation of actin cytoskeleton
ccad04910  Insulin signaling pathway
ccad04912  GnRH signaling pathway
ccad04914  Progesterone-mediated oocyte maturation
ccad04915  Estrogen signaling pathway
ccad04916  Melanogenesis
ccad04917  Prolactin signaling pathway
ccad04919  Thyroid hormone signaling pathway
ccad04921  Oxytocin signaling pathway
ccad04926  Relaxin signaling pathway
ccad04929  GnRH secretion
ccad04933  AGE-RAGE signaling pathway in diabetic complications
ccad04935  Growth hormone synthesis, secretion and action
ccad04960  Aldosterone-regulated sodium reabsorption
ccad05010  Alzheimer disease
ccad05022  Pathways of neurodegeneration - multiple diseases
ccad05034  Alcoholism
ccad05160  Hepatitis C
ccad05161  Hepatitis B
ccad05163  Human cytomegalovirus infection
ccad05165  Human papillomavirus infection
ccad05166  Human T-cell leukemia virus 1 infection
ccad05167  Kaposi sarcoma-associated herpesvirus infection
ccad05170  Human immunodeficiency virus 1 infection
ccad05200  Pathways in cancer
ccad05203  Viral carcinogenesis
ccad05205  Proteoglycans in cancer
ccad05206  MicroRNAs in cancer
ccad05207  Chemical carcinogenesis - receptor activation
ccad05208  Chemical carcinogenesis - reactive oxygen species
ccad05210  Colorectal cancer
ccad05211  Renal cell carcinoma
ccad05212  Pancreatic cancer
ccad05213  Endometrial cancer
ccad05214  Glioma
ccad05215  Prostate cancer
ccad05216  Thyroid cancer
ccad05218  Melanoma
ccad05219  Bladder cancer
ccad05220  Chronic myeloid leukemia
ccad05221  Acute myeloid leukemia
ccad05223  Non-small cell lung cancer
ccad05224  Breast cancer
ccad05225  Hepatocellular carcinoma
ccad05226  Gastric cancer
ccad05230  Central carbon metabolism in cancer
ccad05231  Choline metabolism in cancer
ccad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccad05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122423876 (KRAS)
   04012 ErbB signaling pathway
    122423876 (KRAS)
   04014 Ras signaling pathway
    122423876 (KRAS)
   04015 Rap1 signaling pathway
    122423876 (KRAS)
   04370 VEGF signaling pathway
    122423876 (KRAS)
   04371 Apelin signaling pathway
    122423876 (KRAS)
   04068 FoxO signaling pathway
    122423876 (KRAS)
   04072 Phospholipase D signaling pathway
    122423876 (KRAS)
   04071 Sphingolipid signaling pathway
    122423876 (KRAS)
   04151 PI3K-Akt signaling pathway
    122423876 (KRAS)
   04150 mTOR signaling pathway
    122423876 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122423876 (KRAS)
   04137 Mitophagy - animal
    122423876 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    122423876 (KRAS)
   04218 Cellular senescence
    122423876 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    122423876 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    122423876 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122423876 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    122423876 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    122423876 (KRAS)
   04660 T cell receptor signaling pathway
    122423876 (KRAS)
   04662 B cell receptor signaling pathway
    122423876 (KRAS)
   04664 Fc epsilon RI signaling pathway
    122423876 (KRAS)
   04062 Chemokine signaling pathway
    122423876 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122423876 (KRAS)
   04929 GnRH secretion
    122423876 (KRAS)
   04912 GnRH signaling pathway
    122423876 (KRAS)
   04915 Estrogen signaling pathway
    122423876 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    122423876 (KRAS)
   04917 Prolactin signaling pathway
    122423876 (KRAS)
   04921 Oxytocin signaling pathway
    122423876 (KRAS)
   04926 Relaxin signaling pathway
    122423876 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    122423876 (KRAS)
   04919 Thyroid hormone signaling pathway
    122423876 (KRAS)
   04916 Melanogenesis
    122423876 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122423876 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    122423876 (KRAS)
   04726 Serotonergic synapse
    122423876 (KRAS)
   04720 Long-term potentiation
    122423876 (KRAS)
   04730 Long-term depression
    122423876 (KRAS)
   04722 Neurotrophin signaling pathway
    122423876 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    122423876 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    122423876 (KRAS)
   04213 Longevity regulating pathway - multiple species
    122423876 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    122423876 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122423876 (KRAS)
   05206 MicroRNAs in cancer
    122423876 (KRAS)
   05205 Proteoglycans in cancer
    122423876 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    122423876 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    122423876 (KRAS)
   05203 Viral carcinogenesis
    122423876 (KRAS)
   05230 Central carbon metabolism in cancer
    122423876 (KRAS)
   05231 Choline metabolism in cancer
    122423876 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122423876 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122423876 (KRAS)
   05212 Pancreatic cancer
    122423876 (KRAS)
   05225 Hepatocellular carcinoma
    122423876 (KRAS)
   05226 Gastric cancer
    122423876 (KRAS)
   05214 Glioma
    122423876 (KRAS)
   05216 Thyroid cancer
    122423876 (KRAS)
   05221 Acute myeloid leukemia
    122423876 (KRAS)
   05220 Chronic myeloid leukemia
    122423876 (KRAS)
   05218 Melanoma
    122423876 (KRAS)
   05211 Renal cell carcinoma
    122423876 (KRAS)
   05219 Bladder cancer
    122423876 (KRAS)
   05215 Prostate cancer
    122423876 (KRAS)
   05213 Endometrial cancer
    122423876 (KRAS)
   05224 Breast cancer
    122423876 (KRAS)
   05223 Non-small cell lung cancer
    122423876 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122423876 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    122423876 (KRAS)
   05161 Hepatitis B
    122423876 (KRAS)
   05160 Hepatitis C
    122423876 (KRAS)
   05163 Human cytomegalovirus infection
    122423876 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122423876 (KRAS)
   05165 Human papillomavirus infection
    122423876 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122423876 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    122423876 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    122423876 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122423876 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    122423876 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122423876 (KRAS)
   01522 Endocrine resistance
    122423876 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccad04131]
    122423876 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ccad04031]
    122423876 (KRAS)
Membrane trafficking [BR:ccad04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    122423876 (KRAS)
GTP-binding proteins [BR:ccad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    122423876 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 122423876
NCBI-ProteinID: XP_043297261
LinkDB
Position
21:complement(33874634..33918913)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system