KEGG   Cervus canadensis (wapiti): 122428797
Entry
122428797         CDS       T07554                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad04927  Cortisol synthesis and secretion
ccad04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    122428797
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    122428797
SSDB
Motif
Pfam: MRAP T4SS_pilin FixQ DUF4131
Other DBs
NCBI-GeneID: 122428797
NCBI-ProteinID: XP_043304840
LinkDB
Position
27:complement(2428988..2445235)
AA seq 189 aa
MANRTNTSVPYYSYEYYLDYLDLMPVDEKKLRANKHSIVIAFWVSLAAFMVFLFLILLYM
SWSGSPQTRNNATQRPPTCSWSLCLRLLCIWRQPQHARAPPGDPAASPSLVEEPEAGASR
PVQWLQRESPSTSAPPGPPCSPLGTGPRWGPTGHQLTSATRPVSLACRQNLSMGEPTPQT
HVPSGSLFT
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccaacagaaccaacacctctgtcccatactacagctacgaatactacctggactac
ttggacctcatgcccgtggatgagaagaagctgagagccaacaaacattcgatcgtcatc
gccttctgggtgagcctggcagctttcatggtttttctcttcctcatccttctctacatg
tcctggtcaggctctccgcagacgaggaacaacgccacccagcggcccccaacatgttcc
tggagtctctgcctcaggctgctctgcatctggaggcaaccccagcacgccagggccccc
ccaggggaccctgcagcctcaccgagcttggtcgaggaaccagaagcgggagcatcccgg
cctgtccagtggctgcaacgggagagcccctccacctcggcgcccccaggcccaccctgc
tctcctctgggaactggccctcgatggggccccacagggcaccagctgacgtcagcaaca
cgcccagtgagcctcgcctgcagacagaacctctcgatgggagaaccaacaccccaaacc
cacgtgccctctggaagcctgtttacatag

DBGET integrated database retrieval system