KEGG   Cervus canadensis (wapiti): 122437135
Entry
122437135         CDS       T07554                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad00250  Alanine, aspartate and glutamate metabolism
ccad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    122437135 (RIMKLA)
Enzymes [BR:ccad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     122437135 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     122437135 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Dala_Dala_lig_C Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 122437135
NCBI-ProteinID: XP_043317627
LinkDB
Position
2:complement(98425775..98458758)
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKGVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKKEPDGCASAQGVVESVYAINSGSTSSESEPELGEIRA
SSASTAGAPAPMLPDPSYNINTRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggcctacagctgaaccag
aaggcgctcaccactttcccagacgtggtgcttgtccgcgtgcccacgccctccgtgcag
tcggacagtgacatcaccgtcctgcgacacctggagaagctgggctgccgcttagtcaac
cgcccacagagcattctaaactgcatcaacaaattctggacattccaggagctggctggg
catggggtccccatgccagacaccttctcctatggtggacatgaagacttttcgaagatg
atcgatgaagccgagccgctgggctacccggtggtggtgaagagcacgcggggacaccgg
ggaaaaggtgtttttctcgcaagagataaacaccacctctcagacatctgccacctgatc
cgccacgacgtgccctacctgttccagaagtacgtgaaggagtcccacggaaaggatatc
cgggtggtggtggtcggcggccaggtgataggctccatgcttcgctgctccacagatgga
cggatgcagagcaactgctctctcggtggtgtgggtgttatgtgcccactgacagagcaa
ggcaagcagctggctatccaggtgtccaacatcctgggcatggacttctgtggcatcgat
cttctcatcatggacgatggctccttcgtggtgtgtgaggcaaatgccaacgtgggcttc
ctagccttcgaccaggcatgcaacttagatgtgggcgggatcattgcagactacaccatg
tctttgctgcccaacaggcagaccgggaagatggccgtcctcccaggcttgtctagcccc
agggagaagaaagagccagatggctgtgcttcagctcagggagtcgtggagagcgtctat
gccatcaacagcgggtctacctccagcgagagtgagcctgaactgggagagatccgggct
tcctcagccagcacagcgggggccccggcccccatgctgcctgaccccagctacaacatt
aacaccaggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system