Cervus canadensis (wapiti): 122438684 Help Entry 122438684         CDS       T07554                                  Symbol CENPX Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism ccad  Cervus canadensis (wapiti) Pathway ccad03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ccad00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     122438684 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ccad03400]     122438684 (CENPX) DNA repair and recombination proteins [BR:ccad03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      122438684 (CENPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X HEAT_ULK4 CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  122438684 NCBI-ProteinID:  XP_043319735 LinkDB All DBs Position 1:complement(12078613..12082324) Genome browser AA seq 79 aa AA seqDB search MEETGAVFRKELVSKLLHLHFKDKKTKVSGDALQLMAELLKIFVVEAAIRSVRQAQAEEL DHVDVEQLEKVLPQLLLDF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaggaaaccggagccgtcttccggaaagagctggtgagcaaactgctgcacttgcac tttaaagacaagaagaccaaagtcagtggggatgcgctgcagctcatggccgagctgctg aagatcttcgttgtagaagcggccatccgcagtgtccggcaggcccaggcagaggaactg gaccatgtggatgtggagcagctggagaaggtgctgcctcagctgcttctggacttctag

DBGET integrated database retrieval system