Cervus canadensis (wapiti): 122440157 Help Entry 122440157         CDS       T07554                                  Symbol IL13 Name (RefSeq) interleukin-13 isoform X1   KO K05435   interleukin 13 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04630   JAK-STAT signaling pathway ccad04657   IL-17 signaling pathway ccad04658   Th1 and Th2 cell differentiation ccad04664   Fc epsilon RI signaling pathway ccad05200   Pathways in cancer ccad05310   Asthma ccad05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122440157 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122440157 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     122440157 (IL13)    04657 IL-17 signaling pathway     122440157 (IL13)    04664 Fc epsilon RI signaling pathway     122440157 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122440157 (IL13)   09163 Immune disease    05310 Asthma     122440157 (IL13)    05321 Inflammatory bowel disease     122440157 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122440157 (IL13) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interleukins    122440157 (IL13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  122440157 NCBI-ProteinID:  XP_043321954 LinkDB All DBs Position 4:85514917..85517755 Genome browser AA seq 146 aa AA seqDB search MCLLLNSSCAVLGSMALLLTAVIVLTCFGGLASPGPVPHPTALKELIEELVNITHNQKVP LCNGSMVWSLNLTNSMYCAALDSLISISNCSVIQRTKRMLSALCSHQPSAKQVSSEYVRD TKIEVAQFLKDLLKHSRIAFRNGKFN NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgtgtctgcttctcaattcttcctgtgctgttctaggctccatggcgctcttattgact gcggtcattgttcttacctgctttggtggcctcgcctccccgggccctgtgcctcaccct acagccctcaaggagctcattgaagagctggttaatatcacccacaaccagaaggtgccg ctgtgcaatggcagcatggtgtggagcctcaacctgacgaacagcatgtactgcgcagcc ctggactccctgatcagcatctccaactgcagcgtcatccaaaggaccaagaggatgctg agtgcgctctgttctcaccagccctcagctaagcaggtttccagtgagtacgtccgagac accaaaattgaagtggcccagtttttaaaagacctgctcaaacattcaaggatcgctttt cgcaacggaaaattcaactga

DBGET integrated database retrieval system