Cervus canadensis (wapiti): 122448797 Help Entry 122448797         CDS       T07554                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism ccad  Cervus canadensis (wapiti) Pathway ccad04080   Neuroactive ligand-receptor interaction ccad04081   Hormone signaling ccad04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     122448797 (GHRH)    04081 Hormone signaling     122448797 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     122448797 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122448797 (GHRH) Cytokines and neuropeptides [BR:ccad04052]  Neuropeptides   GPCR binding    122448797 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Ret2_MD Motif Other DBs NCBI-GeneID:  122448797 NCBI-ProteinID:  XP_043336352 LinkDB All DBs Position 10:complement(64998303..65005106) Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSLPSQPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMNRQ QGERNQEQGAKGRLGRQVDGVWTDQQQMALESVLVSLLQKRRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgactctcaccctcagcagcggctcccatggctcc ctgccctcccagcctctcaggatcccacggtatgcagatgccatcttcactaacagctac cggaaggttctgggccagctgtctgcccgcaagctactccaggatatcatgaacaggcag cagggagagagaaaccaggagcaaggagcaaagggccggcttggccgtcaggtggacggc gtgtggacagaccaacagcagatggcattggagagcgtcttggtgagcctgctgcaaaag cgcaggaattcccaaggatga

DBGET integrated database retrieval system