Cervus canadensis (wapiti): 122449542 Help Entry 122449542         CDS       T07554                                  Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04061   Viral protein interaction with cytokine and cytokine receptor ccad04062   Chemokine signaling pathway ccad04620   Toll-like receptor signaling pathway ccad04621   NOD-like receptor signaling pathway ccad04623   Cytosolic DNA-sensing pathway ccad04668   TNF signaling pathway ccad05020   Prion disease ccad05142   Chagas disease ccad05163   Human cytomegalovirus infection ccad05164   Influenza A ccad05168   Herpes simplex virus 1 infection ccad05323   Rheumatoid arthritis ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     122449542   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122449542    04061 Viral protein interaction with cytokine and cytokine receptor     122449542  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122449542    04621 NOD-like receptor signaling pathway     122449542    04623 Cytosolic DNA-sensing pathway     122449542    04062 Chemokine signaling pathway     122449542  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     122449542    05168 Herpes simplex virus 1 infection     122449542    05163 Human cytomegalovirus infection     122449542   09174 Infectious disease: parasitic    05142 Chagas disease     122449542   09163 Immune disease    05323 Rheumatoid arthritis     122449542   09164 Neurodegenerative disease    05020 Prion disease     122449542   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122449542  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122449542    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122449542 Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Chemokines    122449542 Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Chemokines    122449542 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 MF_alpha_N Motif Other DBs NCBI-GeneID:  122449542 NCBI-ProteinID:  XP_043337139 LinkDB All DBs Position 1:complement(45726223..45733039) Genome browser AA seq 91 aa AA seqDB search MKVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYLSRPLPRNHVQEYFYTSSKCSMA AVVFITRKNRQVCANPEKKWVREYINTLELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgccgctgccctcgctgtccttctgacggcggccgccctctgcgctcct gcgtctgcctccccatatgcctcggacaccacaccctgctgctttgcctacctctcccgc ccgctgccccgcaaccacgtccaggaatatttctacaccagcagcaagtgctccatggca gcagtggtctttatcaccagaaagaaccgccaggtgtgcgccaacccagagaagaagtgg gtacgagagtacatcaacactttggagttgagctag

DBGET integrated database retrieval system