KEGG   Cervus canadensis (wapiti): 122452309
Entry
122452309         CDS       T07554                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    122452309 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ccad04050]
    122452309 (TNFRSF8)
   04090 CD molecules [BR:ccad04090]
    122452309 (TNFRSF8)
Cytokine receptors [BR:ccad04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   122452309 (TNFRSF8)
CD molecules [BR:ccad04090]
 Proteins
  122452309 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 122452309
NCBI-ProteinID: XP_043341750
LinkDB
Position
13:37929922..38008471
AA seq 598 aa
MRALRAVLGLLLLGALRAFPQRRAPENDCLGDLSRYYDKAAGKCCHRCREGYSPKQLCPE
GSHHCERQCLHDYYLDINDRCTACVSCSGDLVEKKPCSRNSSRVCECRAGMFCGTSVVNS
CARCIPHSICPAGMVVKLQGTAQRDTVCEPASRGASPNCSTSLQDCKGPTSGAISQAKPT
LTSPASPSARTMLLGGGIPLTPEDASKMTPNSSSFVGKLNPDPGLTPQPPCPQGSADCRK
QCNHDYYLDRDGRCKACVTCSGDGLVEKTPCTWNSSRVCECQPGMFCATPVTNSCARCVT
RPNCPPGTLTKLQGMAETGTTSQAEPSPPGSPPDCSTSPEDRGAPASPTPSLVSLADSLT
GKEHGGGVTHAWEDIPISTSAPISFSSTGKPALVSGPVLFWVILILVVVVSFSSFVLCHR
RACRKWIGQKLHLCYPVQTFRPTLEPVDSKPGRNPILTKSISVADPGNEEQGLLSRPAVE
TCLESLRLLEASPVSNPPSPTDLPEPRGTMEHTNNRIENIYIMKADTVIVGTVKAEVPEG
QGPAGPAGPELEEELETDYASHYPEQETEPPLGSCGDVMFSVEEEGKEDPLPTTVSEK
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgcgcgccctccgtgctgtgcttggtctgttgctcctgggggcgctccgagccttcccg
cagaggcgagcccctgagaatgactgtcttggagacctcagccgctactatgacaaggct
gccgggaagtgctgtcaccgctgccgtgaggggtattccccgaagcagctgtgcccagag
gggtcccaccactgcgagaggcagtgtctgcacgattattacttggacatcaatgaccgc
tgcacggcttgtgtgagctgttctggagacctcgtggagaagaagccatgctcaaggaac
tcctcccgcgtctgtgagtgccgggccggcatgttctgtggcacgtcagtcgtcaactcc
tgtgcccgctgcatcccccattctatctgcccagcagggatggttgtcaagttgcagggc
acagcacagagggacaccgtctgtgagccggcttctcgaggggccagccccaactgcagc
accagcctgcaggactgcaaaggccccaccagtggcgccatctcccaggccaagcccacc
ctgacctccccagcaagccctagtgccaggaccatgcttcttggagggggcatccccctc
accccagaagatgcttctaaaatgactcccaactccagctccttcgtggggaagctcaat
ccagatccagggctgaccccgcagcccccgtgccctcaggggtctgctgactgcaggaag
cagtgtaaccacgactactacctggacagggacggtcgctgcaaggcctgtgtgacatgt
tcaggagatggcctcgtggagaagactccttgcacatggaactcctcccgcgtctgtgag
tgtcagcctggtatgttctgtgccacgccggtgaccaattcctgtgcccgctgtgtcacc
cgccccaactgcccaccagggacgctcaccaagctccagggtatggctgagacaggcacc
acctcccaggctgagccatctccaccagggagccctcctgactgcagcaccagcccggag
gaccgtggggcacctgccagccccaccccctccttggtctccctggccgactccctgact
ggtaaggagcatggagggggtgtcacccacgcctgggaggacatcccaatctcaaccagt
gctcccatctccttctcctccacgggaaagccggctctggtttcaggacctgtgcttttc
tgggtgattctgatactggtggtggtcgtcagcttcagctccttcgtcctgtgccaccgg
agggcctgtaggaagtggattggacagaagctgcatctgtgctacccagtccagaccttc
cggcccacgctggagcctgtggattccaagccggggaggaacccgatactgaccaagagc
atatcagtggcagacccaggcaatgaggagcagggtttactgagccgcccagctgtggag
acctgcctggagagcctgcggctgctggaggccagcccagtcagcaaccccccatccccc
acagacctacctgaaccccgagggaccatggagcacaccaacaacaggattgagaacatc
tacatcatgaaagctgacaccgtgattgtggggaccgtgaaggccgaggtgcctgagggc
caaggcccagcggggccagccgggcccgagctggaggaggagctggagacggactatgcc
tcccactacccggagcaggagacggagccaccgctgggcagctgtggggacgttatgttc
tcggtggaggaagaagggaaggaggatcccttgcccacgaccgtctctgagaaatga

DBGET integrated database retrieval system