KEGG   Castor canadensis (American beaver): 109683957
Entry
109683957         CDS       T04791                                 
Symbol
Tnfrsf8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109683957 (Tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ccan04050]
    109683957 (Tnfrsf8)
   04090 CD molecules [BR:ccan04090]
    109683957 (Tnfrsf8)
Cytokine receptors [BR:ccan04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109683957 (Tnfrsf8)
CD molecules [BR:ccan04090]
 Proteins
  109683957 (Tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 109683957
NCBI-ProteinID: XP_020015652
UniProt: A0A8B7U8R9
LinkDB
Position
Unknown
AA seq 515 aa
MFCVTPVANSCARCRLHSVCPGGMVVKVPGTAEKDTVCGLPSPEAGPGCTSSEDCSTPAR
PMSHVWPMYVQHARKAQKFYEHSSCSQELTAGLWTLVKGPNSSMAQATSTLTSPTTAKAR
TTLLRGGSPVTVRAASGLVRAPKAPSSVGEPSPNPGLSLLQQPCLQGSADCKKQCGPEYY
LDGASRCTACVSCAQDDLVEKAPCSWNSSRVCECRPGMFCVTPVANSCARCIARLNCAPG
TVVKRQGMTKRDTTLEPSPPGTHPDCSTPENSEAPASTAPSLQPLLDSHTISTVSFSSTR
KPILDPGPVLFWVVLVLLVVVGFSSFLLCYWRACRKRIGQKLHLCYPAQTFRPKLERMDS
GPRRNPTQPRSVSVSEPGAEVLSVVRPPSLEMCAHVGASCPESLPLLDDSPATGPLAPRD
PPEPRVSTEHTNNRIEKIYIMKADTVIVGTVKTEVPEGRALAGPTGPELEAELEVDHVPH
YPEQETEPPLGSCDVMFSVEEEGKQDPQPSTASGK
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgttctgtgtcacacccgtcgccaactcctgtgcccgctgccgcctccactctgtctgc
cctggggggatggttgttaaggtcccaggtacggcagagaaggacacggtctgtgggctg
ccttccccagaagctggccccggctgcaccagctcagaggactgtagcacacccgccaga
cccatgagtcatgtgtggcccatgtatgtccagcatgcacggaaggcccagaagttctat
gagcacagctcttgctcccaggagctcacggctggcctgtggacccttgtgaaggggccg
aacagctccatggcccaggccacgtccaccttaacgtccccaaccactgccaaagccagg
accacgcttctgagagggggcagccccgtcactgtacgagctgcttctggtctggtgaga
gctcccaaagctccctcctccgtgggggagcccagtcccaatccaggactgtccctgtta
cagcagccatgcctacagggctctgccgattgcaagaagcagtgtggacccgagtactac
ctggacggggctagccgctgcacagcctgtgtgagctgtgctcaagatgaccttgtggag
aaggcgccgtgctcctggaactcctcccgggtctgcgagtgccggcctggcatgttctgt
gtcacacccgtcgccaactcctgtgcccgctgcattgcccgcctcaactgtgcaccgggg
acagttgtcaaacgccagggtatgactaagagggacaccaccttggagccatctcctcca
gggacccaccctgactgcagcaccccagaaaacagtgaggcgcctgccagcactgccccc
agcctgcagcccctgctggattcccacaccatctccaccgtctctttctcctccacgagg
aagcccattctggatccagggcctgtgctcttctgggtggtcttggtgctgctggtggtg
gttggcttcagctccttccttttgtgttactggagggcctgtaggaagcggattggacaa
aagctccacctgtgctatccggcccagaccttccgtcccaagctggagcgtatggattcc
ggaccaagaaggaacccgacacagccaagaagtgtgtcagtgtcagagccgggagcagaa
gtgctgagtgtcgtgagacccccatctctggagatgtgtgcccatgtgggggcgtcctgc
ccagagagcctgccactgttggatgacagcccggccacaggccccttggcccctagggac
cctcctgagccccgggtgtccacagagcacactaataacaggatcgagaaaatctacatt
atgaaggctgacacggtgattgtgggaaccgtgaagaccgaggtacctgagggccgggct
ctcgcggggcccacagggcctgagttggaggcggagctagaggtggaccatgtccctcac
tacccagagcaggagacggaaccacctctgggcagctgtgatgtcatgttctccgtggag
gaagaagggaagcaggacccccagccctcaaccgcctctgggaagtga

DBGET integrated database retrieval system