Castor canadensis (American beaver): 109694188 Help Entry 109694188         CDS       T04791                                  Symbol Il13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04630   JAK-STAT signaling pathway ccan04657   IL-17 signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04664   Fc epsilon RI signaling pathway ccan05200   Pathways in cancer ccan05310   Asthma ccan05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109694188 (Il13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109694188 (Il13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     109694188 (Il13)    04657 IL-17 signaling pathway     109694188 (Il13)    04664 Fc epsilon RI signaling pathway     109694188 (Il13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109694188 (Il13)   09163 Immune disease    05310 Asthma     109694188 (Il13)    05321 Inflammatory bowel disease     109694188 (Il13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109694188 (Il13) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109694188 (Il13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  109694188 NCBI-ProteinID:  XP_020031569 UniProt:  A0A8B7VKB7 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MALLVTVVLALTCLGGLAAPGPVPHSMALKELIEELVNITQDQKTPLCNGSMVWSADLTA GGYCAALESLANVSSCSTIHKTQKMLNGLCTRKASTRQVSSIRDTKIEVAQFIKTLLRYS QKLYRNEIFN NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggcactcttggtaaccgtggttctagctctcacctgtcttggtggccttgccgcccca ggccctgtgccccactccatggccctgaaggaactcattgaggagctagtcaatatcacg caggaccagaagactcccctctgcaatggcagcatggtgtggagcgctgacctgacagct ggagggtactgtgcagccctggagtctctggctaatgtctccagctgcagcaccatccac aagacccagaagatgctaaacggactctgcacacgcaaggcctcaaccaggcaggtatcc agcatccgagacacgaaaattgaggtggcccagttcataaagaccttgctcagatactca cagaaactttatcgtaatgaaatattcaactga

DBGET integrated database retrieval system