Corynebacterium canis: CCANI_02915 Help Entry CCANI_02915       CDS       T09233                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism ccaw  Corynebacterium canis Pathway ccaw00074   Mycolic acid biosynthesis ccaw00280   Valine, leucine and isoleucine degradation ccaw00630   Glyoxylate and dicarboxylate metabolism ccaw00640   Propanoate metabolism ccaw01100   Metabolic pathways ccaw01110   Biosynthesis of secondary metabolites ccaw01120   Microbial metabolism in diverse environments ccaw01200   Carbon metabolism Module ccaw_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA ccaw_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:ccaw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     CCANI_02915    00640 Propanoate metabolism     CCANI_02915   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     CCANI_02915   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CCANI_02915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Transferase Motif Other DBs NCBI-ProteinID:  WJY74440 LinkDB All DBs Position complement(647685..647918) Genome browser AA seq 77 aa AA seqDB search MSEDITTSEVKKPFLTIVNGNPDDTQVAALTALFATMASNAVAQEAERERNMWGSYDDRL RMHASYNPASFRNVSFY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgaggacatcaccacgagtgaggtcaagaaacccttcctgaccattgtcaacggg aaccccgatgacacccaggtggcagcgctgaccgcgctgtttgcaaccatggcttccaac gccgttgcccaggaagcggaacgcgagcgcaacatgtggggcagctacgacgatcgcctg cgcatgcacgcctcctacaaccccgcctcattccgcaacgtgagcttctactag

DBGET integrated database retrieval system