KEGG   Couchioplanes caeruleus: COUCH_15945
Entry
COUCH_15945       CDS       T08133                                 
Name
(GenBank) SRPBCC family protein
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
ccaz  Couchioplanes caeruleus
Pathway
ccaz01056  Biosynthesis of type II polyketide backbone
ccaz01100  Metabolic pathways
ccaz01110  Biosynthesis of secondary metabolites
Module
ccaz_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:ccaz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    COUCH_15945
Enzymes [BR:ccaz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     COUCH_15945
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: UQU67669
LinkDB
Position
complement(3432015..3432938)
AA seq 307 aa
MTPTRTASSTTVDAPADTVFDHIVDVAPLPHLSPTILHTEHDPVKDDEDVVQIWTVTKDE
QVWSRTIRRSLDRAALRVSFVDEDADGQPTGVRGAWTLRDVSGGKTEVELAFEIDGEAPE
SPERLEAARLDLLTTVTDAAQRRDELADLVVDFTDPLYAAGSAEDAYQILYEADKWPERL
HHVARIDMTENVPNVQFFDMDTSTPDGRAHTTRSVRLCFPHYKIIYKQIGLPALLDAHTG
HWRFTEDRDGLVIESRHTAVIKPSALHILGPGTTVEDARRYLRKVLSTNSMTNLRLAKQF
AEERAGA
NT seq 924 nt   +upstreamnt  +downstreamnt
gtgacaccgacccgcaccgcctcgtccaccacggtcgacgcgcccgccgacacggtcttc
gaccacatcgtcgacgtcgcaccgctgccgcacctgtcccccacgatcctgcacaccgag
cacgacccggtgaaggacgacgaggacgtcgtgcagatctggacggtgaccaaggacgaa
caggtgtggagccgtaccatccggcgcagcctcgaccgggccgcgctgcgcgtctcgttc
gtcgacgaggacgccgacgggcagccgaccggcgtccgcggcgcctggacgctgcgggac
gtctccggcggcaagacggaggtggagctggccttcgagatcgacggcgaggctccggag
tcgccggagcggctggaggccgcccgcctggacctgctcaccacggtcaccgacgcggcg
cagcgccgcgacgaactggcggacctggtcgtcgacttcaccgacccgctgtacgccgcc
ggctccgcggaggacgcctaccagatcctgtacgaggcggacaagtggcccgagcgcctg
caccacgtggcccgcatcgacatgacggagaacgtgcccaacgtccagttcttcgacatg
gacacctcgaccccggacggccgcgcccacaccacccgctcggtacggctgtgcttcccg
cactacaagatcatctacaagcagatcggcctgcccgccctgctggacgcgcacaccggg
cactggcggttcaccgaggaccgcgacggtctcgtcatcgagtcccggcacaccgcggtg
atcaagccgtccgcgctgcacatcctgggcccgggcaccaccgtcgaggacgcccggcgc
tacctgcgcaaggtgctgagcaccaacagcatgacgaacctgcgcctggccaagcagttc
gccgaggagcgggcaggtgcgtga

DBGET integrated database retrieval system