KEGG   Coprinopsis cinerea: CC1G_08427
Entry
CC1G_08427        CDS       T01275                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
cci  Coprinopsis cinerea
Brite
KEGG Orthology (KO) [BR:cci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CC1G_08427
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     CC1G_08427
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 6008388
NCBI-ProteinID: XP_001831910
UniProt: A8NAQ8
LinkDB
Position
7
AA seq 387 aa
MISTSKHLFVLLPLFLVSHLSLVLGFPAYASLGGLTERQVEEYTSKLPIVFPPPPPEPIK
DPWLKLVNDRAHPWRPLRRGDVRGPCPGLNTLASHGYLPRDGVATPAQIITAVQEGFNME
YGIATFVTYAAHLVDGNPLTNLISIGGKTRKTGPDPPPPAIVGGLNTHAVFEGDASMTRG
DFHLGDNFNFNQTLWEQFKDYSNRYGGGRYNLTAAAELRWARIQQSMATNGQFDFTSPRY
FTAYAESVFPINFFTDGRLFTSNTTAPGPDMDSALSFFRDHRYPKDFHRAPVPSGARGLD
VVAAAYPIQPGYNADGKVNNYVLDPTSADFTKFCLLYENFVLKTVKGLYPNPKGFLRKAL
ETNLEYFYQSFPGSGGCPQVFPWGKSD
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgatctcgacctcgaagcatctctttgtgcttcttcctcttttcctagtctcacatctc
tccctcgttctcggtttcccggcgtacgcgtcccttggaggtttaaccgagcgtcaagtc
gaagagtacacgtccaagctccctatcgtctttccaccaccgccgcctgaacctatcaag
gacccgtggctcaagttggtcaatgacagggctcatccatggagaccccttcggagagga
gatgtcagaggaccctgcccggggttgaatacgttggcatcccatgggtatcttcctcga
gatggtgtggcgactccagctcaaatcatcactgccgtccaagaaggcttcaacatggag
tacgggatcgcgacattcgtcacctacgctgcccacctcgtcgatggaaacccactcacc
aatctcatcagcattggtgggaagacgcgcaaaactggccccgatccaccacctcccgcc
atcgttggtgggttgaacactcacgctgttttcgaaggtgatgcgagtatgacccgaggc
gactttcacttgggggataacttcaacttcaaccagacgctttgggagcagttcaaggac
tacagtaaccgctatggaggtggacgatacaacctaactgcggctgctgagcttcgctgg
gcacgtatccagcaatccatggccacgaacggtcaattcgacttcacctcccctcggtac
ttcacagcctacgccgaatccgttttcccaatcaacttcttcacggacggacggctcttc
acttcgaacactaccgcaccaggccccgacatggactcggcgctctccttcttccgggac
cacaggtaccccaaagacttccatcgcgcacccgttccaagtggtgctcgtggactcgat
gtagtcgccgctgcctaccctatccagccgggctacaatgcagatgggaaggtgaacaac
tacgtcctcgacccgacttccgcggatttcacaaagttctgtctgctgtacgagaacttt
gtgttgaagactgtgaaggggctctatccaaatccgaagggcttcttgaggaaggcactg
gagacaaacttggaatacttttaccagtcgttccctgggtcgggaggctgcccgcaggtc
ttcccctggggcaagagtgattag

DBGET integrated database retrieval system