KEGG   Coprinopsis cinerea: CC1G_08981
Entry
CC1G_08981        CDS       T01275                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
cci  Coprinopsis cinerea
Brite
KEGG Orthology (KO) [BR:cci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CC1G_08981
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     CC1G_08981
SSDB
Motif
Pfam: Peroxidase_2 TPD
Other DBs
NCBI-GeneID: 6015412
NCBI-ProteinID: XP_001838817
UniProt: A8P4U7
LinkDB
Position
11
AA seq 386 aa
MNGLFATVKLALVTLLASQSQFANAFPAWQSLGGLSERQLDEVMPMLKHRVPPPPPGPPA
FTGAKLVNDKAHPFKPLKKGDVRGPCPGLNTLASHGYLPRNGVASPSQIIDAVQEGFNME
NELARFTTYVAHLVDGNLVTDLLSIGEKTRKTGPDPPPPAIVGGLNNHGTFEGDASLTRG
DAFFGDNHNFNQELFDQFKNFSAVYGNGFFNMTVAGELRFHRIQQSIATNPEFSLVGLRH
LTAYAEASFPSLFFVDGRKTGAEAGQLDMATAESFFRDMMYPPDFFRPAAPVAGDAGAIF
LAHPFQPGRNVGGVNNFTVDDSLGSLLDFCGFYENFVNKTLKALYPNPKGVLRRNLNINL
QFFFESLPKDESGTPVCTQVFPYGRN
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacggtctgttcgccacagtcaagcttgccttggtcactttactggcttcgcaaagt
caattcgccaacgcctttccggcatggcaatctttgggcgggctatcggagcgacagttg
gacgaagttatgccgatgctgaagcatcgcgttcctccacctccacctggccctccggcc
tttactggcgctaagctcgtgaacgacaaggcccatccattcaagcctctcaaaaagggc
gacgtccgtggaccatgtcctggattgaacaccctagcctcccatgggtacctcccccgc
aacggtgtcgccagcccatcccagatcattgacgccgtccaagaaggtttcaacatggag
aacgagctggctaggtttacgacctatgtcgctcacctcgtcgacggcaaccttgtcact
gacttgctcagtatcggcgagaagacgcgcaagacaggccccgatcctcctcccccggcc
atcgtcggaggtctcaacaaccacggcaccttcgaaggagatgccagtttgacgcgaggc
gacgccttcttcggcgataatcacaacttcaaccaggagctgtttgaccagttcaagaat
ttcagcgcggtgtacggaaacggcttcttcaacatgaccgtcgctggggagcttcgcttc
caccgcatccaacaatccattgcaaccaaccccgagttctctctcgtcggactgcgccat
ctcaccgcctacgcggaagcctcgttcccgtctctcttcttcgtcgatgggcgaaagaca
ggggccgaagcagggcagctcgacatggccacagccgaaagcttcttcagggacatgatg
taccctcctgatttcttcaggcctgcagcgcctgttgctggagatgcgggagccatcttc
ctcgctcaccctttccaaccaggaaggaacgtcggaggcgtcaacaacttcacggtggat
gacagcttgggcagtcttctcgatttctgcgggttctacgagaactttgtcaacaagacg
ctcaaggcactgtaccccaaccccaagggcgtgttgaggaggaatctcaatatcaacctc
cagttcttcttcgagtccttgcccaaggacgagagcggtacccctgtctgcacccaggtg
ttcccctacggacgtaactga

DBGET integrated database retrieval system