Cariama cristata (Red-legged seriema): 104163193 Help Entry 104163193         CDS       T08341                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri04621   NOD-like receptor signaling pathway ccri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccri00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104163193 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104163193 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccri03110]     104163193 (TXN) Chaperones and folding catalysts [BR:ccri03110]  Protein folding catalysts   Protein disulfide isomerase    104163193 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin_7 DIM1 OST3_OST6 Glutaredoxin Thioredoxin_9 Motif Other DBs NCBI-GeneID:  104163193 NCBI-ProteinID:  XP_009700412 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search SEFEAELKSAGEKLIVIDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVDDAQDVATH CDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 294 nt NT seq  +upstreamnt  +downstreamnt tctgaatttgaggcagaactgaaatctgctggtgagaagcttatagtaattgatttctct gccacatggtgtggaccatgcaaaatgatcaagcccttcttccatagtttgtgtgagaag tatggtgatgtggtgttcatcgaaattgatgtggatgatgcccaggatgttgctacacac tgcgatgtgaagtgcatgccaacattccagttctacaagaatggaaagaaggtgcaggag ttctctggggccaataaagagaaactggaagagaccattaaaagtctagtctaa

DBGET integrated database retrieval system