Crocuta crocuta (spotted hyena): 144219659 Help Entry 144219659         CDS       T11532                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04060   Cytokine-cytokine receptor interaction ccru04061   Viral protein interaction with cytokine and cytokine receptor ccru04062   Chemokine signaling pathway ccru04620   Toll-like receptor signaling pathway ccru04621   NOD-like receptor signaling pathway ccru04623   Cytosolic DNA-sensing pathway ccru04668   TNF signaling pathway ccru05020   Prion disease ccru05142   Chagas disease ccru05163   Human cytomegalovirus infection ccru05164   Influenza A ccru05168   Herpes simplex virus 1 infection ccru05323   Rheumatoid arthritis ccru05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     144219659 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     144219659 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     144219659 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     144219659 (CCL5)    04621 NOD-like receptor signaling pathway     144219659 (CCL5)    04623 Cytosolic DNA-sensing pathway     144219659 (CCL5)    04062 Chemokine signaling pathway     144219659 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     144219659 (CCL5)    05168 Herpes simplex virus 1 infection     144219659 (CCL5)    05163 Human cytomegalovirus infection     144219659 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     144219659 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     144219659 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     144219659 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     144219659 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccru04052]     144219659 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:ccru00536]     144219659 (CCL5) Cytokines and neuropeptides [BR:ccru04052]  Cytokines   Chemokines    144219659 (CCL5) Glycosaminoglycan binding proteins [BR:ccru00536]  Heparan sulfate / Heparin   Chemokines    144219659 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  144219659 NCBI-ProteinID:  XP_077605842 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAAPFAVLLAAAAFCAPASASPYASDTTPCCFAYLSHPLPLRHLQEYFYTSSKCSMP AVVFVTRRKRQVCANPQEKWVRDHINSLEMN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagctccctttgcagtcctcctcgctgctgccgccttctgtgctcct gcctctgcctctccatatgcctcggacaccaccccctgctgctttgcctacctctcccac ccacttcccctcaggcacctccaggagtatttctacaccagcagcaagtgctccatgcca gcagtcgtctttgtcacccgaaggaagcgccaggtgtgtgccaacccacaggagaaatgg gtgcgggaccacatcaactctctggagatgaactag

DBGET integrated database retrieval system