Corvus cornix (hooded crow): 120411704 Help Entry 120411704         CDS       T03546                                  Symbol CD24 Name (RefSeq) signal transducer CD24   KO K06469   CD24 antigen Organism ccw  Corvus cornix (hooded crow) Pathway ccw04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ccw00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     120411704 (CD24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:ccw04090]     120411704 (CD24)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccw00537]     120411704 (CD24) CD molecules [BR:ccw04090]  Proteins   120411704 (CD24) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccw00537]  Antigens   120411704 (CD24) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD24 Motif Other DBs NCBI-GeneID:  120411704 NCBI-ProteinID:  XP_039425194 LinkDB All DBs Position 3:70365922..70370669 Genome browser AA seq 86 aa AA seqDB search MGMGTALAARLGLGLLLLALLLPTQIYCGPNGTSPTPSNNSSASSTSLSAVTNSVNNTTT HGHGNSLHSTTSLFFILSVSLLYLCC NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgggcatggggacggcgctggcggcgcggctcggcctggggctcctgctccttgccctc ctccttcccacgcagatctactgtggtcccaatggaacaagtccaacaccttcaaacaat tcttcagcaagttccacttctctgtcagctgtcacaaattcagtgaacaataccaccact cacggacatggaaattctcttcactcaaccacaagtctttttttcattctctcagtttcg cttctgtatctttgctgttaa

DBGET integrated database retrieval system