Camelus dromedarius (Arabian camel): 105084993 Help Entry 105084993         CDS       T04642                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04080   Neuroactive ligand-receptor interaction cdk04081   Hormone signaling cdk04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105084993 (GHRH)    04081 Hormone signaling     105084993 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105084993 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105084993 (GHRH) Cytokines and neuropeptides [BR:cdk04052]  Neuropeptides   GPCR binding    105084993 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Titin_Z Motif Other DBs NCBI-GeneID:  105084993 NCBI-ProteinID:  XP_010973518 LinkDB All DBs Position 19:19418079..19426227 Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSPPTQPLRMPRYADAIFTNSYRKVLGQLSALKLLQGIMSKQ QGERNQEQGARVRAGRQVDGVWADQKQMELESTLVALLQQHRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttccttgtgaccctcaccctcagcagcggctcccacggttcc ccacccacccagcccctcaggatgccgcggtacgcagatgctatcttcaccaatagctac cggaaggtgctgggccagctgtctgccctcaagctgctccagggcatcatgagcaaacag cagggagagagaaaccaggagcaaggagcaagggtacgggctggccgtcaggtggacggt gtgtgggcagaccaaaagcagatggaattggagagcaccctggtggccctgctgcagcag cacaggaattcccaagggtga

DBGET integrated database retrieval system