KEGG   Camelus dromedarius (Arabian camel): 105098872
Entry
105098872         CDS       T04642                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04927  Cortisol synthesis and secretion
cdk04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    105098872 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105098872 (MRAP)
SSDB
Motif
Pfam: MRAP bCoV_NS7B
Other DBs
NCBI-GeneID: 105098872
NCBI-ProteinID: XP_010989933
LinkDB
Position
1:113002452..113017741
AA seq 160 aa
MANRTNASAAYYSYEYYMDYLDLIPVDEKKLKANKHSIVIAFWVSLAAFVLFLFLILLYM
SWSGPSQTRNSTQRHPMCRWSLSLNLPLCVWRHCLCHRAPPQVTPSXSPPPHPPPPSPHL
SSGNWPSTRTRTASADIGNEPSEPPLQTQPPDLRTDRSRC
NT seq 483 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaacgcctccgccgcgtactacagctacgaatactacatggactac
ttggacctcattcctgtggatgagaagaagctgaaagccaacaaacactcgatcgtcatc
gccttctgggtgagcctggctgctttcgtgctgtttctcttcctcatcctgctctacatg
tcctggtcaggcccctcgcagaccaggaacagcacgcagcgccaccccatgtgccgctgg
agtctcagtctcaacctcccgctctgcgtctggaggcactgcctgtgccacagggccccc
ccccaggtgaccccctccncctccccccccccccacccaccaccccccagcccccacctc
tcctctgggaactggccctcgacgcggactcgcacggcatccgctgacatcgggaatgag
cccagcgagcctcccctgcagacacaacctcctgaccttagaaccgaccggagccgctgc
tga

DBGET integrated database retrieval system