KEGG   Castellaniella defragrans: BN940_14136
Entry
BN940_14136       CDS       T03058                                 
Name
(GenBank) Linalool dehydratase-isomerase precursor protein LDI
  KO
K20614  linalool dehydratase / geraniol isomerase [EC:4.2.1.127 5.4.4.4]
Organism
cdn  Castellaniella defragrans
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN940_14136
Enzymes [BR:cdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.127  linalool dehydratase
     BN940_14136
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.4  geraniol isomerase
     BN940_14136
SSDB
Motif
Pfam: Ldi Glyco_hydro_8
Other DBs
NCBI-ProteinID: CDM25272
UniProt: W8X534
Structure
LinkDB
Position
complement(3065225..3066430)
AA seq 401 aa
MRLNMRFTLKTTAIVSAAALLAGFGPPPRAAELPPGRLATTEDYFAQQAKQAVTPDVMAQ
LAYMNYIDFISPFYSRGCSFEAWELKHTPQRVIKYSIAFYAYGLASVALIDPKLRALAGH
DLDIAVSKMKCKRVWGDWEEDGFGTDPIEKENIMYKGHLNLMYGLYQLVTGSRRYEAEHA
HLTRIIHDEIAANPFAGIVCEPDNYFVQCNSVAYLSLWVYDRLHGTDYRAATRAWLDFIQ
KDLIDPERGAFYLSYHPESGAVKPWISAYTTAWTLAMVHGMDPAFSERYYPRFKQTFVEV
YDEGRKARVRETAGTDDADGGVGLASAFTLLLAREMGDQQLFDQLLNHLEPPAKPSIVSA
SLRYEHPGSLLFDELLFLAKVHAGFGALLRMPPPAAKLAGK
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcgactgaacatgcggttcacattgaagacgacggcgattgtgtcggccgccgccctg
ctggccggtttcgggccgccgccccgcgcggcggaactgccgccggggcggctcgccacc
accgaggactatttcgcgcagcaggcgaagcaggccgtcacccccgacgtgatggcccag
ctggcctacatgaactacatcgatttcatctcgcccttctacagccggggctgctccttc
gaggcctgggagctcaagcacacgccgcagcgggtcatcaagtattcgatcgccttctat
gcgtatggcctggccagcgtggcgctcatcgacccgaagctgcgtgcgctcgccggccat
gacctggacatcgcggtctccaagatgaagtgcaagcgggtctggggcgactgggaggaa
gacgggttcggcaccgacccgatcgagaaagagaacatcatgtacaagggccacctgaac
ctgatgtacggcctctatcagctggtgaccggcagccgccggtacgaagccgagcatgcc
cacctcacccgcatcatccatgacgagatcgcggccaacccctttgccggcatcgtctgc
gagccggacaattattttgtccagtgcaattcggtcgcctacctgagcctgtgggtctat
gaccggctgcatggcaccgactaccgggcggccaccagggcctggctggatttcatccag
aaggacctgatcgatcccgagcggggcgccttctacctgtcctatcaccccgagtccggc
gcggtgaagccgtggatctcggcgtatacgacagcctggacgctcgccatggtgcacggc
atggaccccgccttttccgagcgctactacccccggttcaagcagaccttcgtcgaggtc
tacgacgagggccgcaaggcccgggtgcgcgagacggccggcacggacgacgcggatggc
ggggtgggcctggcttcggcgttcaccctgctgctggcccgcgagatgggcgaccagcag
ctcttcgaccaattgctgaatcacctggagccgccggccaagccgagcatcgtctcggcc
tcgctgcggtacgagcatcccggcagcctgctgttcgacgagctgctgttcctcgccaag
gtgcatgccggctttggcgccctgcttcggatgccgcctccggcggccaagctcgcaggg
aaataa

DBGET integrated database retrieval system