KEGG   Candida dubliniensis: CD36_82520
Entry
CD36_82520        CDS       T01140                                 
Name
(RefSeq) DNA damage checkpoint protein, putative
  KO
K06663  DNA damage checkpoint protein
Organism
cdu  Candida dubliniensis
Pathway
cdu04111  Cell cycle - yeast
cdu04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CD36_82520
   04113 Meiosis - yeast
    CD36_82520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cdu03400]
    CD36_82520
DNA repair and recombination proteins [BR:cdu03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    CD36_82520
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 8046672
NCBI-ProteinID: XP_002419189
UniProt: B9WDM2
LinkDB
Position
3:596202..597617
AA seq 471 aa
MVFEAEIGVNKHKLMWSKSIASLSNIAEAITFTITKDSISLSATNTSKTSYARIHFKKTF
FNKFSVDFNNILPEGYDNGKERKEDPSYSFLINSRHMATLFKSLDSGGMKYVSFRINWSR
NAPINSRYKLLIEIHTKKLIVKKFQASYTPATKQNLQIASTYKDTLSKQQEDNLHDKTRI
NHIMMDQVIPKQFLEMVPASAEDFKIDIKSERISLCGYTKQIIKDRDYLKQPMAVTVTIS
LEELTDTNLLSLNSDQEPIRKQINFGMRDFKNFLNLANFFTTPSSFSERFDEDYITTANN
DYFHIFFRNPGDPILFDLQNHQHAEVQFIQITSEDKSELHSKEIDANLIRKNLTIEAPIP
QKIQNNNTTTTTTPSLTRPMINTVFGKPSKTRKREKDRFSNKVQLSQGTMNDDFDDGVTY
GLEPERERGNYAETDYSNSSGEESKEPPFKKHAPDQELGPTQLNNKPKSIF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggtatttgaagcagaaatcggagtcaataagcataagcttatgtggtcaaaatccata
gcgtccctttcaaatatagcagaagcaataacgttcaccataaccaaagattccatatcc
ttgtctgcaaccaacacaagtaaaacctcctacgctcgaatacatttcaagaaaaccttt
ttcaataaattttcggttgattttaataacatattaccagaaggatatgataatgggaaa
gaacggaaagaagaccccagttattcttttcttatcaattcacgacacatggcaacattg
ttcaaaagtctagattcaggtggcatgaaatatgtaagttttaggataaactggtcccgc
aatgctccaataaatctgaggtataaattgttgattgaaatccatacaaagaaattgatt
gttaaaaagttccaagctagttatactccagcaacgaaacagaaccttcaaattgcttct
acttataaggacaccctatctaaacaacaagaagataatttacacgataaaacccgaatc
aaccacataatgatggaccaagtgatacccaaacagtttcttgaaatggttccagcatct
gccgaggattttaaaatagatatcaagagtgaaagaatactgctttgtgggtacaccaaa
caaataatcaaagatagagattatttgaaacaaccaatggcagttacagtaactattagt
ctagaagaattaactgacaccaatttactactgttgaattcagatcaagaaccaattaga
aaacaaattaattttggcatgcgtgatttcaagaattttttgaatttagcaaattttttc
acaactccatcgtcattttctgaacgattcgatgaagattatataacaacagcaaataat
gattatttccacatatttttcagaaaccctggagatcctatattatttgatttgcaaaat
caccaacatgcagaagttcaatttattcagattacttccgaagataaatcagagttacat
tcgaaggaaattgacgcaaatttaattagaaagaacttgacaatagaagcaccaatacct
caaaaaattcaaaacaacaatacaactacaacaacaacaccatcattgactcgaccgatg
attaatactgtatttggtaaaccttcaaaaacaaggaaaagagaaaaagataggttcagc
aacaaagttcaattatctcaaggaactatgaatgatgacttcgatgatggagttacatat
ggactagaaccagaaagagaaagaggaaattatgccgaaaccgattatagtaatagttct
ggtgaagaatccaaagaaccaccttttaaaaaacatgcaccagaccaagaacttggtcct
acacaattgaacaataaacccaaatcgatattttaa

DBGET integrated database retrieval system