Corynebacterium deserti: CDES_03580 Help Entry CDES_03580        CDS       T04068                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism cdx  Corynebacterium deserti Pathway cdx00074   Mycolic acid biosynthesis cdx00280   Valine, leucine and isoleucine degradation cdx00630   Glyoxylate and dicarboxylate metabolism cdx00640   Propanoate metabolism cdx01100   Metabolic pathways cdx01110   Biosynthesis of secondary metabolites cdx01120   Microbial metabolism in diverse environments cdx01200   Carbon metabolism Module cdx_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:cdx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     CDES_03580    00640 Propanoate metabolism     CDES_03580   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     CDES_03580   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CDES_03580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon T2SSK Motif Other DBs NCBI-ProteinID:  ALC05168 UniProt:  A0A0M5ITT7 LinkDB All DBs Position complement(729319..729558) Genome browser AA seq 79 aa AA seqDB search MSEVTSEFVVEKPFLQVVSGNPNDAEVAALTMVFAGLAQAAAAEQATQSRDRDNWGNLDE RLSRPTTFNPSAFQNVNFF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagttacttctgagttcgtcgtcgaaaagccgtttttgcaggttgtctccggc aaccctaacgacgccgaagtcgccgcgctgaccatggtcttcgcaggccttgcccaggca gccgccgctgagcaagcaacccagtcccgcgaccgcgacaactggggcaacctcgacgag cgcctcagccgccccaccaccttcaaccccagcgcattccagaacgtaaacttcttctaa

DBGET integrated database retrieval system