Canis lupus familiaris (dog): 474181 Help Entry 474181            CDS       T01007                                  Symbol IFNA7 Name (RefSeq) interferon alpha-1/2 precursor   KO K05414   interferon alpha Organism cfa  Canis lupus familiaris (dog) Pathway cfa04060   Cytokine-cytokine receptor interaction cfa04151   PI3K-Akt signaling pathway cfa04217   Necroptosis cfa04620   Toll-like receptor signaling pathway cfa04621   NOD-like receptor signaling pathway cfa04622   RIG-I-like receptor signaling pathway cfa04623   Cytosolic DNA-sensing pathway cfa04630   JAK-STAT signaling pathway cfa04650   Natural killer cell mediated cytotoxicity cfa04936   Alcoholic liver disease cfa05152   Tuberculosis cfa05160   Hepatitis C cfa05161   Hepatitis B cfa05162   Measles cfa05163   Human cytomegalovirus infection cfa05164   Influenza A cfa05165   Human papillomavirus infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05168   Herpes simplex virus 1 infection cfa05169   Epstein-Barr virus infection cfa05170   Human immunodeficiency virus 1 infection cfa05171   Coronavirus disease - COVID-19 cfa05200   Pathways in cancer cfa05320   Autoimmune thyroid disease cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     474181 (IFNA7)    04151 PI3K-Akt signaling pathway     474181 (IFNA7)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     474181 (IFNA7)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     474181 (IFNA7)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     474181 (IFNA7)    04621 NOD-like receptor signaling pathway     474181 (IFNA7)    04622 RIG-I-like receptor signaling pathway     474181 (IFNA7)    04623 Cytosolic DNA-sensing pathway     474181 (IFNA7)    04650 Natural killer cell mediated cytotoxicity     474181 (IFNA7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     474181 (IFNA7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     474181 (IFNA7)    05161 Hepatitis B     474181 (IFNA7)    05160 Hepatitis C     474181 (IFNA7)    05171 Coronavirus disease - COVID-19     474181 (IFNA7)    05164 Influenza A     474181 (IFNA7)    05162 Measles     474181 (IFNA7)    05168 Herpes simplex virus 1 infection     474181 (IFNA7)    05163 Human cytomegalovirus infection     474181 (IFNA7)    05167 Kaposi sarcoma-associated herpesvirus infection     474181 (IFNA7)    05169 Epstein-Barr virus infection     474181 (IFNA7)    05165 Human papillomavirus infection     474181 (IFNA7)   09171 Infectious disease: bacterial    05152 Tuberculosis     474181 (IFNA7)   09163 Immune disease    05320 Autoimmune thyroid disease     474181 (IFNA7)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     474181 (IFNA7)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     474181 (IFNA7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     474181 (IFNA7) Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Interferons    474181 (IFNA7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  474181 NCBI-ProteinID:  NP_001006655 Ensembl:  ENSCAFG00000048694 UniProt:  A0A8C0TEL2 Q75UL5 LinkDB All DBs Position 11:39535467..39536030 Genome browser AA seq 187 aa AA seqDB search MALPCSFSVALVLLSCHSLCCLACHLPDTHGLRNWRVLTLLGQMRRLSAGSCDHYTNDFA FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCPDTSSAPWNMTLLEELCSGLSEQLDDLE ACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSSTILQ ERIRRKE NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttctcggtggccctggtgctgctcagctgccactccctgtgc tgtctggcttgccacctgcccgacacccacggcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctccgccggctcttgtgaccactacaccaatgactttgcc ttccccaaggagctgtttgatggccagcggctccaggaggcgcaggccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcccggacacgtcctctgctccttgg aacatgactctcctggaggaactgtgctcggggctctctgagcagctggatgacctggag gcctgtcccctgcaggaggcggggctggccgagacccccctcatgcatgaggactccacc ctgaggacctacttccaaaggatctccctctacctgcaagacaggaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttgcaa gaaagaatcaggaggaaggaatga

DBGET integrated database retrieval system