Canis lupus familiaris (dog): 485863 Help Entry 485863            CDS       T01007                                  Symbol GHRH Name (RefSeq) somatoliberin precursor   KO K05260   growth hormone-releasing hormone Organism cfa  Canis lupus familiaris (dog) Pathway cfa04080   Neuroactive ligand-receptor interaction cfa04081   Hormone signaling cfa04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     485863 (GHRH)    04081 Hormone signaling     485863 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     485863 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     485863 (GHRH) Cytokines and neuropeptides [BR:cfa04052]  Neuropeptides   GPCR binding    485863 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  485863 NCBI-ProteinID:  NP_001277041 Ensembl:  ENSCAFG00000008743 VGNC:  41207 UniProt:  A0A8C0SWR7 A0A8I3PVA0 LinkDB All DBs Position 24:complement(25542127..25546302) Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVILTLSSGSHSSPPSLPIRIPRYADAIFTNSYRKVLGQLSARKLLQDIMSRQ QGERNREQGAKVRLGRQVDSLWASQKQMALENILASLLQKRRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcaccctcagcagtggctcccactcttcc ccgccatccctgcccatcagaatccctcggtatgcagacgccatcttcaccaacagctac cggaaggtgctgggccagctgtccgcccgcaagctcctgcaggacatcatgagccggcag cagggagagagaaaccgggagcaaggagcaaaggtacgactcggccgtcaggtggacagt ctgtgggcaagccaaaagcagatggcattggagaacatcctggcatccctgttacagaaa cgcaggaattcccaaggatga

DBGET integrated database retrieval system