Corynebacterium faecale: CFAEC_03085 Help Entry CFAEC_03085       CDS       T09289                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism cfac  Corynebacterium faecale Pathway cfac00074   Mycolic acid biosynthesis cfac00280   Valine, leucine and isoleucine degradation cfac00630   Glyoxylate and dicarboxylate metabolism cfac00640   Propanoate metabolism cfac01100   Metabolic pathways cfac01110   Biosynthesis of secondary metabolites cfac01120   Microbial metabolism in diverse environments cfac01200   Carbon metabolism Module cfac_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA cfac_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:cfac00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     CFAEC_03085    00640 Propanoate metabolism     CFAEC_03085   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     CFAEC_03085   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CFAEC_03085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  WJY91472 LinkDB All DBs Position complement(661776..662015) Genome browser AA seq 79 aa AA seqDB search MSEETTTEAPQKPFLQVLSGNPDASQVAALTVLFAGLASSAAASQDAAEKDRNSWGSLEE RLQRPTTYNPNAFQNVSFF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgaagagaccaccactgaggcaccacagaagccatttcttcaggttttgtccggt aatccggatgccagccaggtggctgccctgaccgtcctgtttgcaggtctggcctcttcg gcggcagcatcccaggacgcagccgagaaggatcgcaacagttggggaagcctggaggag cgtctgcagcgccccaccacctacaaccccaacgccttccagaacgtgagcttcttctag

DBGET integrated database retrieval system