Chamaea fasciata (wrentit): 136296550 Help Entry 136296550         CDS       T11360                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism cfai  Chamaea fasciata (wrentit) Pathway cfai03082   ATP-dependent chromatin remodeling cfai04217   Necroptosis Brite KEGG Orthology (KO) [BR:cfai00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136296550  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136296550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfai03036]     136296550   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfai04147]     136296550 Chromosome and associated proteins [BR:cfai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136296550 Exosome [BR:cfai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136296550 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  136296550 NCBI-ProteinID:  XP_066051791 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MSGRGKSGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQSSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccggggaaagtccggcggaaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctccagttccccgtggggcgggtgcaccggctgctgcggaagggtaactac gcggagcgggtgggcgccggggcgccggtgtacctggcggccgtgctggagtacctgtcg gctgagatcctggagctggcgggcaacgcggctcgcgacaacaagaagacgcgcatcatc ccgcggcacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acgcagagctccaagaagtga

DBGET integrated database retrieval system