KEGG   Camelus ferus (Wild Bactrian camel): 102504346
Entry
102504346         CDS       T02979                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04927  Cortisol synthesis and secretion
cfr04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102504346 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102504346 (MRAP)
SSDB
Motif
Pfam: MRAP bCoV_NS7B DUF4131
Other DBs
NCBI-GeneID: 102504346
NCBI-ProteinID: XP_032332306
UniProt: A0A8B8SQ62
LinkDB
Position
1:complement(11221953..11237330)
AA seq 184 aa
MANRTNASAAYYSYEYYMDYLDLIPVDEKKLKANKHSIVIAFWVSLAAFVLFLFLILLYM
SWSGPSQTRNSTQRHSMCRWSLSLNLPLCVWRHCLCHRAPQGTRSLHPAWVRNQAAEQPA
LPSSSRSWRAPPPRPPPPPRPPPLSSGNWPSTRTRTASADIGNEPSEPPLQTQPPDRRTD
RSRC
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaacgcctccgccgcgtactacagctacgaatactacatggactac
ttggacctcattcctgtggatgagaagaagctgaaagccaacaaacactcgatcgtcatc
gccttctgggtgagcctggctgctttcgtgctgtttctcttcctcatcctgctctacatg
tcctggtcaggcccctcgcagaccaggaacagcacgcagcgccactccatgtgccgctgg
agtctcagtctcaacctcccgctctgcgtctggaggcactgcctgtgccacagggccccc
caggggacccgcagcctccacccagcgtgggtgaggaatcaggccgccgagcagccagcc
ctgcccagcagcagccgcagctggagagcccctccacctcgccccccaccaccccccagg
cccccaccgctctcctctgggaactggccctcgacgcggactcgcacggcatccgctgac
atcgggaacgagcccagcgagcctcccctgcagacacaacctcctgaccgtagaaccgac
cggagccgctgctga

DBGET integrated database retrieval system