Camelus ferus (Wild Bactrian camel): 102509773 Help Entry 102509773         CDS       T02979                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04080   Neuroactive ligand-receptor interaction cfr04081   Hormone signaling cfr04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102509773 (GHRH)    04081 Hormone signaling     102509773 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102509773 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102509773 (GHRH) Cytokines and neuropeptides [BR:cfr04052]  Neuropeptides   GPCR binding    102509773 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Titin_Z Motif Other DBs NCBI-GeneID:  102509773 NCBI-ProteinID:  XP_032317072 UniProt:  A0A8B8RGR6 LinkDB All DBs Position 19:complement(39466589..39474741) Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSPPTQPLRMPRYADAIFTNSYRKVLGQLSALKLLQGIMSKQ QGERNQEQGARVRAGRQVDGVWADQKQMELESTLVALLQQHRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccacggttcc ccacccacccagcccctcaggatgccgcggtacgcagatgccatcttcaccaatagctac cggaaggtgctgggccagctgtctgccctcaagctgctccagggcatcatgagcaaacag cagggagagagaaaccaggagcaaggagcaagggtacgggctggccgtcaggtggacggt gtgtgggcagaccaaaagcagatggaattggagagcaccctggtggccctgctgcagcag cacaggaattcccaagggtga

DBGET integrated database retrieval system