KEGG   Camelus ferus (Wild Bactrian camel): 102522941
Entry
102522941         CDS       T02979                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00250  Alanine, aspartate and glutamate metabolism
cfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102522941 (RIMKLA)
Enzymes [BR:cfr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     102522941 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     102522941 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATP-grasp Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 102522941
NCBI-ProteinID: XP_006174585
UniProt: A0A8B6YAD1
LinkDB
Position
13:30327524..30357907
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVSFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGRVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPTRQTGKMAVLPGLSSPREKKEPDGCASAQGVAESVYAINSGSTSSESEPELGELRD
SSASTTGAPAPMLPDPGYNINNRIASELRLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgagcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggtttgcagctgaaccag
aaggcgctcaccaccttcccagacgtggtgcttgtcagggtgcccacaccctctgtgcaa
tcggatagtgacatcacagtcctgagacacctggagaagttgggctgccgcttagtcaac
cgcccacagagcattttaaactgcatcaacaaattctggacgttccaggagctggctgga
catggggtccccatgccagataccttctcctacggtgggcatgaagacttttccaaaatg
atcgatgaagccgagccgctgggctacccggtggtggtgaaaagcacgcgcggacaccgg
ggaaaagctgtttttctcgcaagagataaacaccacctctcagatatctgccatctgatc
cgccacgacgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggatatc
cgggtggtggttgttgggggccgggtgataggctccatgcttcgctgctccacagacgga
cggatgcagagcaattgctctctcggtggcgtgggtgtcatgtgcccgctgacagaacaa
ggcaagcagttggctatccaggtgtccaacatcctgggcatggacttctgtggcatcgat
ctcctcatcatggacgatggctcctttgtggtgtgcgaggcaaacgccaacgtcggtttc
ctagccttcgaccaggcgtgcaacttagacgtgggtgggatcattgcggactacaccatg
tccttgctgcccaccaggcagactgggaagatggccgtcctcccaggactgtctagtccc
agagagaagaaggagccagatggctgtgcttcagctcagggagtagcagagagcgtctac
gccatcaacagtgggtctacctccagcgagagtgagcctgaactgggagagctccgggat
tcctcagcgagcacgacgggggccccggcccccatgctgcccgaccccggctacaacatt
aacaacaggattgcttccgagttaagactaaagtga

DBGET integrated database retrieval system